KEGG   Azospirillum brasilense Sp7: AMK58_24550Help
Entry
AMK58_24550       CDS       T04566                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00250  Alanine, aspartate and glutamate metabolism
abf00330  Arginine and proline metabolism
abf01100  Metabolic pathways
abf01110  Biosynthesis of secondary metabolites
abf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMK58_24550 (putA)
   00330 Arginine and proline metabolism
    AMK58_24550 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:abf03000]
    AMK58_24550 (putA)
Enzymes [BR:abf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AMK58_24550 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     AMK58_24550 (putA)
Transcription factors [BR:abf03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    AMK58_24550 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ALJ38635
UniProt: A0A0N7I8Z1
Position
ABSP7_p2:complement(725701..729441)
Genome map
AA seq 1246 aa AA seqDB search
MNSMTNPTATRADTRTAPPSAASGGAAPFADFAPPIRPATELRAAITAAYRRPEPECLPF
LFGQAALPPGIVTAAAGTARKLITALRAKPRGRGVEGLIHEYSLSSQEGMALMCLAEALL
RIPDHATRDALIRDKIAGGDWQAHLGKGGSMFVNAATWGLLITGKLTSAGGEQALSSALT
RLIARGGEPLIRRGVDFAMRMMGEQFVTGQTIQEALTNARPMEAEGFRYSYDMLGEAALT
AEDAARYYADYENAIHAIGKASAGRGVYEGPGISIKLSAIHPRYSRAQADRVMDELLPRV
KALALLAKGYDIGLNIDAEEADRLELSLDLMESLCFDPDLAGWNGIGFVVQAYGKRCPYV
IDFLVDLARRSGHRLMIRLVKGAYWDSEIKRAQLDGLPDFPVYTRKVYTDVSYVACARKL
LAAPEAVFPQFATHNAQTLATIYEMAGSDFQVGKYEFQCLHGMGEPLYKEVVGPLKRPCR
IYAPVGTHETLLAYLVRRLLENGANSSFVNRIADPAVPVDELVADPVAVARAIAPLGAPH
ALIALPRNLYAPERANSAGIDLSDETELARLSAALSASAEMTWTAAPLLADGERAGQAQP
VRNPADRRDVVGTVTEASEALVAEAFGHAVAAAPAWAATPPEERAASLFRAADAMQERMP
TLLGLIVREAGKSLPNAIAEVREAIDFLRYYGAQARDRFDNATHRPLGPVVCISPWNFPL
AIFSGQIAAALAAGNPVLAKPAEETPLIAAEAVRILHAAGIPAGALQLLPGAGEVGAALV
GNEAVRGVMFTGSTEVARLIQRQLAGRLLPDGGTIPLIAETGGQNAMIVDSSALAEQVVG
DVIASAFDSAGQRCSALRILCLQEDVADRTLAMLKGAMRELRIGNPDRLAVDVGPVISEE
ARATIAGHIEAMRAKGRNVEFLPLPAETAEGTFIAPTVIEIGGIHELEREVFGPVLHVVR
FHRDALDALVDAINATGYGLTFGLHTRIDATIERVTGRIGAGNVYVNRNTIGAVVGVQPF
GGHGLSGTGPKAGGPLYLSRLLSRRPKGWLEFRGPDAARAAGLAYGEWLRAKGFTAEASR
CAGYVARSAIGGGAELNGPVGERNLYELHGRGRVLLLPQTRTGLLLQLGAVLATGNSAAV
DAPPELAELLRGLPPALAARVRTTADWRDAGPLAAVLVEGDRECVTAINRRIAELPGPIL
LVQAATPEALAAGRGEGYDLDLLLNERSVSVNTAAAGGNASLVAMS
NT seq 3741 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatgaccaacccgaccgccacccgggccgacacccggaccgcccccccgtcc
gccgcttccggcggcgcggcgcccttcgcggacttcgccccgccgatccgtccggcgacc
gagctgcgcgccgcgatcaccgccgcctaccgccggccagagccggagtgcctgcccttc
ctgttcgggcaggccgcgctgccgcccggcatcgtcaccgcggcggcgggcaccgcccgc
aagctgatcaccgccctgcgcgccaagccgcggggccgcggcgtcgaggggctgatccac
gaatacagcctgtccagccaggagggcatggcgctgatgtgtctggcggaggcgctgctg
cgcatccccgaccacgccacgcgcgacgcgctgatccgcgacaagatcgccggcggcgac
tggcaggcgcatctcggcaagggcggctcgatgttcgtcaacgccgccacctggggcctg
ctgatcaccggcaagctgacctcggcgggcggcgagcaggcgctgtcctccgccctgacg
cgcctgatcgcgcgcggcggcgaaccgctgatccgccgcggcgtcgatttcgccatgcgc
atgatgggcgagcagttcgtcaccggccagaccatccaggaggcgctgaccaacgcccgc
cccatggaggccgagggcttccgctactcctacgacatgctgggcgaggcggcgctgacg
gcggaggacgccgcgcgctactacgccgactacgaaaacgccatccatgccatcggcaag
gcgtcggcggggcgcggcgtctatgaggggccgggcatctccatcaagctgtcggcgatc
cacccgcgctattcccgcgcccaagccgaccgggtgatggacgagctgctgccgcgcgtg
aaggcgctggcgctgctcgccaagggctacgacatcggcctgaacatcgacgccgaggag
gccgaccggctggagctgtcgctcgacctgatggaatcgctgtgcttcgatccggatctg
gcgggctggaacggcatcggcttcgtcgtgcaggcctacggcaagcgctgcccctacgtc
atcgacttcctggtcgatctggcgcggcgcagcggccaccggctgatgatccggctggtc
aagggcgcctattgggacagcgagatcaagcgcgcccagctcgacggcctgcccgacttc
ccggtctacacgcgcaaggtctacaccgacgtctcctacgtcgcctgcgcgcgcaagctg
ctcgctgccccggaggcggtgttcccgcagttcgccacccacaacgcccagacgctcgcc
accatctacgagatggccggcagcgacttccaggtcggcaagtacgagttccagtgcctg
cacggcatgggcgagccgctctacaaggaggtcgtcggcccgctgaagcggccctgccgc
atctatgcgccggtcggcacgcacgagacgctgctggcctatctggtccgccgcctgctg
gagaacggggccaacagctccttcgtcaaccgcatcgccgacccggcggtcccggtcgac
gagctggtcgccgacccggtggcggtcgccagggccatcgccccgctgggcgcgccgcac
gcactgatcgccctgccgcggaacctctatgcgccggagcgggcgaattccgccggcatc
gacctgtccgacgagacggagctggcccgcctgtccgccgccctgtcggccagcgccgaa
atgacttggaccgcggcgccgctgctggccgacggcgagcgggcggggcaggcccagccg
gtgcgcaacccggccgatcgccgcgacgtggtcggcacggtgactgaggcgagcgaggcc
ctggtggcggaggccttcggccacgccgtcgcggcggcgcccgcctgggccgccaccccg
ccggaggaacgcgccgccagcctgttccgcgccgccgacgccatgcaggagcggatgccg
accctgctcggcctgatcgtccgcgaggccggcaagtcgctgcccaacgccatcgccgag
gtgcgggaggccatcgacttcctgcgctattacggggcgcaggcgcgcgaccgcttcgac
aacgccacccatcgcccgctggggccggtggtctgcatcagcccgtggaatttcccgctg
gccatcttctccggccagatcgccgcggcgctggccgccggcaacccggtgctggcgaag
ccggccgaggaaaccccgctgatcgccgccgaggccgtgcgcatcctgcacgcggccggc
atccccgccggggcgctccagcttctccccggcgcgggcgaggtcggcgccgccctggtc
gggaacgaggcggtgcgcggcgtgatgttcaccggctccaccgaggtggcgcggctgatc
cagcgccagctcgccgggcgcctgctgccggacggtgggacgatcccgctgatcgccgag
accggcggccagaacgccatgatcgtggacagctccgccctggccgagcaggtggtgggc
gacgtgatcgcgtccgccttcgacagcgccggccagcgctgctccgccctgcgcatcctc
tgcctgcaggaggacgtggccgaccgcacgctcgccatgctgaagggcgccatgcgggag
ctgcgcatcggcaacccggaccggctggccgtcgatgtcggcccggtcatcagcgaggag
gcccgcgccaccatcgccggccacatcgaggcgatgcgcgccaagggccgcaatgtggag
tttctgccgctgcccgccgagacggccgagggcaccttcatcgcccccacggtgatcgag
atcggcggcatccatgagcttgagcgggaggtcttcggcccggtcctccacgtcgtccgc
ttccaccgcgacgctctcgacgccctggtcgacgccatcaacgccaccggctacggcctg
accttcggcctgcacacccgcatcgacgccaccatcgagcgggtgaccgggcggatcggc
gcgggcaacgtctacgtcaaccgcaacaccatcggcgcggtggtcggcgtgcagcccttc
ggcggccacggcctgtcgggcaccggccccaaggcgggcggcccgctctacctctcccgc
ctgctcagccgccgtcccaagggctggctggagttccgcgggccggacgccgcacgcgcg
gccgggctggcctacggcgagtggctgcgcgccaagggcttcacggcggaggcgtcgcgc
tgcgccggctacgtggcgcgcagcgccatcggcggcggggcggagctgaacggcccggtg
ggcgagcgcaacctctatgagctgcacgggcggggccgtgtcctgctgctgccgcagacg
cggacgggcctgctgctccagctcggcgcggtcctggcgacgggcaacagcgccgcggtg
gacgccccgccggagttggccgagctgctgcgcggcctgcccccggcgctggccgcgcgg
gtgcggaccacggcggattggcgggacgccggaccgctcgccgcggttctggtggaaggc
gaccgcgaatgcgtgaccgccatcaaccggcgcatcgcggagcttcccggcccgatcctg
ctggtgcaggcggcgacccccgaggctttggcggcggggcggggcgagggctacgacctc
gacctgctgctgaacgagcgctcggtcagcgtcaacaccgcggcggccggcggcaacgcc
agcctcgtcgcgatgagctga

DBGET integrated database retrieval system