KEGG   Azospirillum brasilense Sp7: AMK58_26795Help
Entry
AMK58_26795       CDS       T04566                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00071  Fatty acid degradation
abf00072  Synthesis and degradation of ketone bodies
abf00280  Valine, leucine and isoleucine degradation
abf00310  Lysine degradation
abf00362  Benzoate degradation
abf00380  Tryptophan metabolism
abf00620  Pyruvate metabolism
abf00630  Glyoxylate and dicarboxylate metabolism
abf00640  Propanoate metabolism
abf00650  Butanoate metabolism
abf00900  Terpenoid backbone biosynthesis
abf01100  Metabolic pathways
abf01110  Biosynthesis of secondary metabolites
abf01120  Microbial metabolism in diverse environments
abf01130  Biosynthesis of antibiotics
abf01200  Carbon metabolism
abf01212  Fatty acid metabolism
abf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMK58_26795
   00630 Glyoxylate and dicarboxylate metabolism
    AMK58_26795
   00640 Propanoate metabolism
    AMK58_26795
   00650 Butanoate metabolism
    AMK58_26795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMK58_26795
   00072 Synthesis and degradation of ketone bodies
    AMK58_26795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMK58_26795
   00310 Lysine degradation
    AMK58_26795
   00380 Tryptophan metabolism
    AMK58_26795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMK58_26795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMK58_26795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMK58_26795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abf04147]
    AMK58_26795
Enzymes [BR:abf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMK58_26795
Exosome [BR:abf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMK58_26795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF434
Motif
Other DBs
NCBI-ProteinID: ALJ39086
UniProt: A0A0P0EXK5
Position
ABSP7_p3:418636..419811
Genome map
AA seq 391 aa AA seqDB search
MTEVVIASAARTPIGSFNGALSSVPAHYLGEIAIREALSRAKTDAAEVTEVILGQILTAG
QGQNPARQAAVNAGIPASATAFGINQLCGSGLRSVALGYQAIRNGDAEVMVVGGQESMSQ
APHVMHLRNGVKMGAAEMLDTMLKDGLMDAFKGYHMGTTAENVAQKWQLTRDEQDAFAAA
SQQKAEAAQKSGRFKDEIIPVTIKGRKGDIIVADDEYPKHGTTAESLAKLRPAFSKEGTV
TAGNASGINDGAAALVLMTAENAAKRGLTPLARIVSWATAGVDPAIMGTGPIPASRLALE
KAGWKHEDLDLIEANEAFAAQALAVNKDLGWDTSKVNVNGGAIALGHPVGASGARVLTTL
LYEMQKRDAKKGLATLCIGGGMGIALTVERG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttgtgatcgccagcgcagcgcgtactcccattggcagcttcaacggggcg
ctcagcagcgtgccggcccattacctgggtgagatcgccatccgcgaagcgctgagccgc
gccaagaccgacgccgcggaggtgaccgaggtcatcctgggccagatcctgaccgccggt
cagggccagaacccggcccgccaggccgccgtcaacgccggcatcccggcctccgccacc
gccttcggcatcaaccagctctgcggctcgggcctgcgttcggtggcgctcggctatcag
gcgatccgcaacggcgacgccgaggtcatggtcgtcggcggccaggagagcatgagccag
gccccgcacgtcatgcatttgcgcaacggcgtgaagatgggcgccgccgagatgctcgac
accatgctgaaggacggcctgatggacgccttcaagggctaccacatgggcacgacggcc
gagaacgtcgcccagaagtggcagctgacccgcgacgagcaggacgccttcgccgccgcc
tcgcagcagaaggccgaggctgcccagaagtccggccgcttcaaggacgagatcatcccg
gtcaccatcaagggccgcaagggcgacatcatcgtcgccgacgacgagtatccgaagcac
ggcaccaccgcggaatcgctggccaagctgcgcccggccttctccaaggagggcacggtg
accgccggcaacgcgtcgggcatcaacgacggcgccgccgcgctcgtcctgatgaccgcc
gagaacgcggccaagcgcggcctgaccccgctggcccgcatcgtctcctgggcgaccgcc
ggcgtcgatccggcgatcatgggcactggcccgatcccggcgtcccgcctcgcgctggag
aaggccggctggaagcacgaggacctggacctgatcgaggcgaacgaggccttcgccgcg
caggccctggccgtgaacaaggaccttggctgggacacctccaaggtcaacgtcaacggc
ggcgccatcgcgctcggccacccggtcggcgcgtccggcgcccgcgtcctgaccaccctg
ctctatgagatgcagaagcgcgatgccaagaagggcctcgccaccttgtgcatcggcggc
ggcatgggcatcgccctcaccgtcgagcggggctga

DBGET integrated database retrieval system