KEGG   Asaia bogorensis: Asbog_00423Help
Entry
Asbog_00423       CDS       T04138                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
abg  Asaia bogorensis
Pathway
abg00260  Glycine, serine and threonine metabolism
abg01100  Metabolic pathways
abg01110  Biosynthesis of secondary metabolites
abg01120  Microbial metabolism in diverse environments
abg01130  Biosynthesis of antibiotics
abg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asbog_00423
Enzymes [BR:abg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Asbog_00423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAT18732
UniProt: A0A0P0YE65
Position
461434..462480
Genome map
AA seq 348 aa AA seqDB search
MTEAIRKNFASDNIAPVCPEVMNALIRINKGAAPSYGEDSETERLTALMRDAFDHPVWVF
PVATGTAANSLALSASTAPFGAVICDQSAHIANDEGGAPEFFMHGARLMPLPSPDGRMDP
AALDRALVTNGEGGVHTSPIQTLSLTQSTEWGTVYSLDHLAALTSRARESGLATHLDGAR
LGNSIAALNCTPAEITWKAGFDMVSFGGTKNGGMASEAVLIFKEELARNFSRRIKRGGHL
WSKQRYLSAQLAALVENDLWLRHALHANTMAQRLAHGLRRHPAASLPFEVQSNEVFVVLP
ERSVAALEAQGFVFYRWTTPPGIDGVLIRLVTCWATEARDVDHFLEAL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcaatacgcaagaacttcgcaagtgacaacatcgcgccagtctgccccgag
gtgatgaatgctctcatacgcatcaacaaaggggcagcgccgtcttatggcgaggattcc
gaaacagaaagactgacagcgctcatgcgcgacgccttcgatcacccggtctgggtgttt
cctgtggccaccggtacggccgccaacagtcttgcgctgtccgcatccaccgcgcctttc
ggtgctgttatctgcgaccagagcgctcatatcgccaatgatgagggtggggcaccagag
ttcttcatgcatggggcgaggctgatgcccctgccttcgcctgacgggcgcatggatccc
gccgcccttgaccgcgcactcgtcaccaatggcgaaggcggagtccatacaagcccgatc
cagacactttcactgacacaaagtacggaatggggcacggtctattctcttgaccatctt
gcagccctgacgtcacgcgccagagagtccggccttgccacgcatctggatggtgcccgt
ctgggcaattccattgctgcactcaattgcacacctgccgagataacctggaaggccggg
ttcgacatggtgagcttcggcggcacgaagaatggcggcatggcgtcagaggccgtgctg
atcttcaaggaagaactggcaagaaacttttcccggcgtatcaagcgtggtgggcatctc
tggtcgaagcagcgttatctgagcgcacagctcgcggcgctggtggaaaatgatctgtgg
ctgcgtcatgccctgcatgccaacaccatggctcagcgcctcgctcatggcttgcgccgc
catcctgcggcgtctctgcccttcgaggtgcagagcaatgaggtgtttgtcgtgctgcct
gaacgcagcgtggccgcgctggaggctcagggtttcgtgttctatcgctggacaacgccg
ccgggtatcgacggggtattgatacgcctcgtgacctgctgggcgaccgaagcgcgggat
gtggatcactttctcgaggcgctctga

DBGET integrated database retrieval system