KEGG   Asaia bogorensis: Asbog_01983Help
Entry
Asbog_01983       CDS       T04138                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
abg  Asaia bogorensis
Pathway
abg00250  Alanine, aspartate and glutamate metabolism
abg00650  Butanoate metabolism
abg00760  Nicotinate and nicotinamide metabolism
abg01100  Metabolic pathways
abg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Asbog_01983
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asbog_01983
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Asbog_01983
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     Asbog_01983
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     Asbog_01983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAT20241
UniProt: A0A0P0YHN8
Position
2192720..2194102
Genome map
AA seq 460 aa AA seqDB search
MTHPASGDCVFTVNPATGETLGRYPFLSEQAVDDMLARAQEGFMSWRAKTLGARLDLLHR
LAAGLRARKEELARLAVSEMGKTITSARAEVEKCASVIDWYGEHAPALLRDKPMPVPMGK
AHLSYAPTGIVLAVMPWNFPYWQIIRAAVPILAGGNGFIVKPAENTLGCGALLNEIAQDC
DLGDVFISANLAREQTARVIADERISGVTVTGSVRVGRLLAGMAGENGKKTVLELGGSDP
FIVLADADLDKAVDAAVTARFANCGQVCIAAKRIILEAPIAEAFTERFLDKVRALRLEDP
MSDGAFIGPMARTDLRDGLHKQVQQSIAEGARVVVGGEAVNRPGAWYEPTVLLDVTPGMT
AFSEELFGPVACLITAQDIDHAITLANDSAYGLGASLWTQDERLGLALSQRIESGGVFIN
RITASDPALPIGGVKASGYGRELTELGLHEFMNIKTVWAC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacccatcctgcgtcaggcgattgcgtattcacggtcaacccggccaccggagaaacg
ctggggcgctacccgtttctgtcggagcaggcggtcgatgacatgctggcccgtgcccag
gaggggtttatgtcatggcgcgccaaaaccttgggcgcacggcttgatctgctccaccgt
cttgcagcagggcttcgtgcgcgcaaggaggagctggcccgccttgccgtgagtgaaatg
ggcaaaaccataacttcagcgcgtgccgaagtcgaaaaatgcgcctcggttatcgactgg
tatggcgaacacgcaccggccttgctgagggacaaacccatgcccgtaccgatgggcaag
gcccatctgagctacgcgcctaccggcattgtgctggcggttatgccgtggaatttcccg
tactggcagatcattcgcgctgccgtgcccattctggccggaggcaatggttttatcgtg
aagcctgccgaaaacacgctgggctgcggcgcattgctgaatgagatcgcgcaggattgc
gatcttggcgatgtgttcatctccgccaatctcgctcgtgagcagaccgcacgcgtcatt
gccgatgagcggatttcaggcgtgacggttacgggcagtgtcagggtcgggcgtctcctc
gctgggatggccggtgagaacggcaagaagaccgttctggaactgggtgggtctgacccg
ttcatcgtgctggctgatgccgatctggacaaggccgtcgatgccgccgtgacggcgcgc
ttcgcaaattgcgggcaggtctgcattgccgccaagcggatcatcctcgaagcgccgatt
gccgaggccttcacggaacgttttctcgataaggtaagagcgcttcgtctcgaagatcct
atgagtgatggcgcctttatcggcccgatggcacgcactgacctgcgcgatggcctgcac
aagcaggtgcagcagagcatcgcggaaggtgcgcgggttgtggtcggcggcgaggctgtg
aaccgtcccggtgcgtggtacgagccgaccgtgctactggacgtcacccccggcatgacc
gccttcagcgaagagcttttcgggcctgtcgcctgcctgatcacggcacaggatatcgat
catgccattacgctggccaatgacagtgcctatggccttggcgcgagcctgtggacacag
gatgagcgccttggtcttgctctgtcacagcgcatcgaatcgggtggcgtattcatcaac
cgtatcaccgcctcggaccccgctttgccgatcggtggcgttaaggcgagtggctacggg
cgcgaattgaccgaactcggcctgcatgagttcatgaacatcaagacggtctgggcctgc
tga

DBGET integrated database retrieval system