KEGG   Asaia bogorensis: Asbog_02419Help
Entry
Asbog_02419       CDS       T04138                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
abg  Asaia bogorensis
Pathway
abg00030  Pentose phosphate pathway
abg00480  Glutathione metabolism
abg01100  Metabolic pathways
abg01110  Biosynthesis of secondary metabolites
abg01120  Microbial metabolism in diverse environments
abg01130  Biosynthesis of antibiotics
abg01200  Carbon metabolism
Module
abg_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
abg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
abg_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asbog_02419 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Asbog_02419 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abg04147]
    Asbog_02419 (zwf)
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Asbog_02419 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Asbog_02419 (zwf)
Exosome [BR:abg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Asbog_02419 (zwf)
  Exosomal proteins of colorectal cancer cells
   Asbog_02419 (zwf)
  Exosomal proteins of bladder cancer cells
   Asbog_02419 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N bMG10
Motif
Other DBs
NCBI-ProteinID: BAT20673
UniProt: A0A0P0YJC4
Position
complement(2733429..2734934)
Genome map
AA seq 501 aa AA seqDB search
MTSPADQLQNVLGQTSASQPCKLVIFGAGGDLTRRLLLTSLYDLAVANALPAGFQIIAID
RDEQKAQDWADRHFALAEQDAKDPSAEFSCPHLDRRAWDRVTHNAQYIAGDFTRPELFTT
LSETLGGDSAIFYCAVAARFFAPIATALGEAGLLAEKAGFRRIVIEKPFGHDLASARALD
ETLRRQARESQIYRIDHFMGKEANQGILVARFSNVLFEPLWRREYIDHVQITAAETIGVE
SRGAFYEHTGALRDMVPNHLFVLLSLIAMEPPSSLAAEAIRQEKTRLLEAIRPVRAQDYV
AGQYGAGEIAGSPVAAYRSEPGVATDSQTETYVAMRLDIDNWRWGGVPFYLRTGKRMKAR
RTEINIVFKKPPYALFNQDMNDPRTGNVIRFLLDPVRGVSIGFDAKQPGLEEVIAPVTSS
FLYDSFFPKAPNVGYEALLHDCMAGNQMLFQSAGTIEAAWAAIDNVATTPVTPCLYEAGS
QGPAEADALLARDGRQWLPVA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccctgctgaccagcttcagaatgttctcgggcaaacttccgcctctcaaccc
tgcaagctggtcattttcggagccgggggcgatctgacgcgccgcctgcttctcacgtcg
ctttacgatctggctgtggcaaacgcccttccagccggatttcagatcatcgcgattgat
cgcgacgagcaaaaggcccaggactgggccgaccgtcatttcgctctggcagagcaggat
gcaaaagatccctctgccgagttctcatgccctcatctcgatcgtagggcgtgggacagg
gtgacccacaacgcacaatatatagcgggcgacttcactcggcccgagcttttcaccacc
ctgtcggaaaccctcggtggggacagcgccattttctattgtgcggtcgcggcccgtttc
ttcgcgccgattgcaaccgctctgggtgaggcggggcttcttgcggagaaggcggggttc
aggcgtatcgtgatcgagaagcctttcggccacgatctggcatcggccagggcactcgat
gaaaccctgcgtcggcaggcccgtgaaagccagatctatcgcattgatcatttcatgggc
aaggaagccaatcagggtatccttgtcgcgcgcttctccaacgtcctgttcgagccccta
tggcgtcgcgaatatatcgaccatgtgcagatcacggctgccgagacgattggcgttgaa
agccggggcgctttctatgagcacacaggcgctctgcgcgacatggtgcccaaccatctg
ttcgtcctgctcagcctcatcgcaatggagccaccatcatctctggccgctgaggccata
cgacaggaaaaaacgcgattgctggaagccatacgcccggtgcgcgcgcaggattacgtg
gcgggccagtacggagcaggtgagattgccggatcacccgtcgcggcctatcgcagcgaa
ccgggtgttgcgaccgatagccagacagaaacctacgttgccatgcgactggatatcgat
aactggcgctggggtggggtgcccttttatttgcgcacgggcaaacgcatgaaggcccga
cgcaccgagatcaacattgtctttaaaaagccgccttatgcgcttttcaatcaggacatg
aacgacccgcgcacaggcaatgtcatccgctttcttctcgatcctgtccggggcgtttcc
atagggtttgatgccaagcagcccggactggaagaggtgattgcccccgtgaccagcagt
tttctctacgactcgtttttcccgaaggcgccgaatgtcggctacgaggcgctgctgcat
gactgcatggcgggcaaccagatgcttttccagagcgcgggcaccattgaggccgcctgg
gcggcgattgacaatgtcgctaccacccctgttacgccttgcctttatgaagcggggtca
cagggaccggccgaggcggatgccctgcttgcccgcgatgggcgtcagtggcttccggtg
gcctga

DBGET integrated database retrieval system