KEGG   Acinetobacter baumannii TYTH-1: M3Q_1665
Entry
M3Q_1665          CDS       T02261                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
abh  Acinetobacter baumannii TYTH-1
Brite
KEGG Orthology (KO) [BR:abh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abh02044]
    M3Q_1665
Secretion system [BR:abh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M3Q_1665
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: AFU37757
Position
1760737..1761240
AA seq 167 aa
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctcctcgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggcagttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaacagt
gagcgtttagaagatctgcttgatgaggttcttaaaaatactgatcaaatccgtaaatta
agtgccgaggccgatcatgaataa

DBGET integrated database retrieval system