KEGG   Acinetobacter baumannii TYTH-1: M3Q_1668
Entry
M3Q_1668          CDS       T02261                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
abh  Acinetobacter baumannii TYTH-1
Brite
KEGG Orthology (KO) [BR:abh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abh02044]
    M3Q_1668
Secretion system [BR:abh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M3Q_1668
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFU37760
Position
1763347..1763823
AA seq 158 aa
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDD
YPLVKKSILQFGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMG
ALCLSIQAYLNIHPLYEPVVFDALLKPTTQQYVISART
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaacttagatcggctttatccatacggatttcgttcaactttatttgatcgtttaatt
ccagaaagtgaagattatgcaaaaggtctttctattcagcaattaagagaatctgtagca
aaggatttagaagatttgctcaatagtcgggtagcaaagttagatcatgtgattgatgac
tatccacttgtaaaaaaatcgatacttcagttcgggattattgattttgtggggctttct
acagccaaccctctggatcgggataaaatttgccaatccattgagcaatcaatagcagct
catgaacctcggctaagacaaatacgggtagagatgttattagatggacataatatgggc
gcattatgtttaagtattcaggcttatctaaatattcaccccttatatgaacctgttgta
tttgatgcattgttaaaaccaacaacgcagcaatatgtaatttcagcaagaacttaa

DBGET integrated database retrieval system