KEGG   Acinetobacter baumannii TYTH-1: M3Q_1679
Entry
M3Q_1679          CDS       T02261                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M3Q_1679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abh02044]
    M3Q_1679
Secretion system [BR:abh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M3Q_1679
SSDB
Motif
Pfam: DotU Sigma_reg_N
Other DBs
NCBI-ProteinID: AFU37771
Position
1779342..1780148
AA seq 268 aa
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQR
FREKILDLLNRFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISP
LQLSLFGSQLAGYQFFEILEQLRSRGKDRLAALEVFHYCLLLGFQGKYRIESIESLNHLV
ARVGDEIDYLKGKKVAFSPFSAIPDQIRNIIHRELPFFWILIFLLIFALLTFAGLRFMLN
NQNDKALSNYQNVISAPQEQAHITIYLP
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcacaatctacaggtgctccttctttatttgacgatgggcaaattgggacagggggg
aacaataatagccagtcccaagtaaaattacaggcaattaatctgattgatttattgcat
gatggtttttacttaatctttttaattcgaaatcagtatgtgccagctgatccacagcgc
tttcgtgaaaaaattctagatttgcttaatcgatttgagcaacaagcgaaaaagttacaa
ttttcagctgatgatattcatgatgctaaatatgcgttttgtgcgctaattgatgaaacg
atcgtaacccagcaagacccaagctattttaatttacaaaattcttggttaattagtcca
ttacagttaagcctgtttggttcacagttagcgggttatcaattcttcgaaattttagag
caactacgtagtcgtggaaaagatcgattagctgctcttgaagtcttccattactgctta
ttattaggttttcagggtaaataccgaattgagtcaattgaaagccttaaccatttggtg
gcacgagtaggcgatgaaattgattatctgaaagggaaaaaagtggctttttcgccattc
tcggcaattcctgatcagatacgaaatattatccatcgtgagttaccttttttctggatt
ttgattttcttattgatttttgcattacttacctttgcaggtttaagatttatgcttaac
aatcaaaatgataaagcattatctaattatcaaaatgtgatttctgccccacaagagcag
gcacatattacaatttacttaccttga

DBGET integrated database retrieval system