KEGG   Acinetobacter baumannii TYTH-1: M3Q_2088Help
Entry
M3Q_2088          CDS       T02261                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00010  Glycolysis / Gluconeogenesis
abh00020  Citrate cycle (TCA cycle)
abh00620  Pyruvate metabolism
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01200  Carbon metabolism
Module
abh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M3Q_2088
   00020 Citrate cycle (TCA cycle)
    M3Q_2088
   00620 Pyruvate metabolism
    M3Q_2088
Enzymes [BR:abh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M3Q_2088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFU38180
Position
2205482..2207017
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCADNEVSDAEIEKFIASLGGSAAQAPAAPSEQSKAETSVPVAE
KAEQPLTTAASASAPAKVAKGDYAVPESLQGYQTSDDLFATPHALKLAEKHNVNLAKVTG
SGREGRISVQDIQKTVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGIN
LNDCRVSGTRGRVCKEDVEAVYYRNNPVSVSEQPLQCATQPQSTVTTVAMNGMRKAIASR
LQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNV
QFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQ
PDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATL
SCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccaaaatggggattatccatggaagaaggcacg
atcgcccaatggttgattaaagagggtgatagctttaataagggcgatgaaatttgtgaa
attgaaaccacaaaaatcgtcaatgtgttagaagcgccttttgctggaacgctccgtaaa
attttagcgaaagatggtgatactttacctgttggtggacttattgccgtatgtgctgat
aatgaagtttctgatgcagaaattgaaaagtttatcgcatcactaggtggttcagcagct
caagcacctgcagcaccttcggaacaaagtaaagcggaaacatctgtacctgttgctgaa
aaagcagaacagccactgactacagcagctagtgcttcagctcctgcaaaggtagctaaa
ggggactacgctgtaccagagtcattacaaggctatcaaacatctgatgatttgtttgca
acaccacatgcgttaaagcttgcagaaaagcacaatgtaaacttggcaaaagtcacaggt
tctggtcgtgaaggacgtattagtgttcaagacatccagaagactgtacaggctgctggt
ggtcagtggcctgatgttaagcagcaaactcaaactaaagtggttaaatctacagctgat
gatagccaaattttagcgacgcctgtagcacgccgtttagcaaaacaatggggcattaac
ctaaatgactgccgtgtttcaggtactcgtggccgtgtctgtaaagaagatgttgaggca
gtttactatcgtaataacccagtgtcggtaagtgaacaacctttgcaatgtgcaactcaa
ccacaatcaaccgttacgacggtggcgatgaatgggatgcgtaaagcgattgcttcacgg
ttacaggctgcaaaacgtaacgcaccgcatttccgcttagtggtcgatctcaacgtagaa
gctttgcaaaaactacgtaagcagattaatgagactgttccacaagtgaaactttctatt
aatgacatgctaattaaggcagcggcggcggcactgattaaagtacctgaagtgaatgtt
caatttgatgaggcgactcaatcaattttacagttctctcaagcggatatttcggtggcc
gtagcgattccaaacggtttaattacacccattgtaaaagcagcaaatcaaaaatcgttg
gcacaaatttccgatgacatgcgtgatttggcaactcgtgctaagactggcaagttacaa
cctgacgagtttcagggtggtagctttagcatttcaaatttaggaatgttaggcattaaa
cagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggtgcttcggaa
tctcgtgctgttgttgaaaatggcaatgtagtggttcgtgagattgtcacagcgacgttg
tcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagctttaag
cagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system