KEGG   Acinetobacter baumannii TYTH-1: M3Q_2297Help
Entry
M3Q_2297          CDS       T02261                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00040  Pentose and glucuronate interconversions
abh00053  Ascorbate and aldarate metabolism
abh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M3Q_2297
   00053 Ascorbate and aldarate metabolism
    M3Q_2297
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     M3Q_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh AIRS Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AFU38387
Position
complement(2438236..2439810)
Genome map
AA seq 524 aa AA seqDB search
MVIGHNFIGGSRSAQGTTLLKSIQATTGEALPYEFHHATEQEINQACEAASQAFKTYRHT
TPEQRAVFLENIADELDALGTDFLEIVSQETALPLARLQGERARTSGQMRLFAKVLRRGD
FLGARIDTALPERQPLPRPDLRQIKIGVGPVAVFGASNFPLAFSTAGGDTASALAAGCSV
VVKAHSGHMATADFVAQAIERAVEKSNMPKGVFNMIYGNGVGEPLVKHPLIQAVGFTGSL
RGGRALCDMAAARPQPIPVFAEMSSINPMLMLPEALKNRGEKIAQDLADSVVLGCGQFCT
NPGLILGIKSAEFSQLINNLTDIMGAKPAQTMLNAGTLKSYTAGLEHLTQHQGIKHLAGN
TQQGNQAQPQLLKADVELLLAGDQLLQEEIFGPTTVVIEVEDKAQLIQALQSMNGQLTAT
LIADEADLTEFADVVPVLEEKAGRLLINGYPTGVEVCDAMVHGGPYPATSDARGTSVGTL
AIDRYLRPVCYQNYPQSLLPEALKDSNPLQILRLVNGEMTREAI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtcattggacacaactttattggcggttcacgcagcgcacaaggtacaaccttatta
aaaagtattcaagctacgactggtgaagctttgccttatgagtttcaccatgcaaccgag
caagagattaatcaggcctgtgaagcagccagtcaagcctttaagacttaccgccatacc
acacctgaacagcgtgctgtttttttagaaaatattgcagatgaactcgatgctttgggt
accgattttctagaaattgtctcacaggaaactgctttgccacttgcacgtttacaaggt
gaacgtgcccggaccagtgggcaaatgcgcctgtttgctaaagtgctgcgccgtggtgat
tttttaggtgcccgtattgataccgctttgcctgagcgccagcctttacctcgcccagac
ctgcgtcagattaaaatcggtgtaggccctgttgcagtctttggggcaagtaactttcct
ttagcattctcaactgcgggtggtgacactgcttcggcactggcagcaggttgctctgta
gtggtgaaagcccatagtggacacatggcgacagcagattttgtagcgcaggcaattgag
cgtgccgtagaaaaatcaaatatgcctaaaggcgtatttaacatgatctacggtaatggt
gtgggtgaaccactggttaagcatcctttaattcaagctgtgggttttacaggttcattg
cgtggtggacgagctttatgtgatatggccgcagcccgtccacaaccgattccggtgttt
gctgaaatgagcagtattaacccgatgctgatgttgccagaagccttaaaaaaccgtggt
gaaaaaattgcacaggatttggcagattcagtggttttaggctgtggtcagttctgtacc
aatccgggtttaatcttgggaattaaatcagctgaatttagtcagctcattaacaacctg
accgacattatgggggctaagcctgcgcagactatgctcaatgccggcaccttaaaaagt
tacaccgctggtcttgagcacttgacccagcatcaaggcattaagcatttggctggcaat
actcaacaaggtaatcaggcgcagccacaactgcttaaagctgatgttgagcttttactg
gcgggtgaccagcttttacaagaagaaatctttgggccaaccacagtcgtcattgaagtt
gaagataaagcccaactcattcaggcactacaaagtatgaatgggcaattgactgcgact
ttaattgccgatgaagctgacttaaccgagtttgcagatgtagttccagttttagaggaa
aaagccggtcgattacttataaatggctacccaactggtgttgaggtctgtgatgccatg
gttcatggtgggccatacccagccacttcagatgcacgaggtacttcagttggaaccttg
gccattgaccgttacttgcgccctgtgtgttaccagaactatccacagagtctattgccg
gaagccttaaaagacagcaacccgttgcagattttaagattggtcaatggtgagatgacc
agagaagcgatctaa

DBGET integrated database retrieval system