KEGG   Acinetobacter baumannii TYTH-1: M3Q_3329Help
Entry
M3Q_3329          CDS       T02261                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00071  Fatty acid degradation
abh00072  Synthesis and degradation of ketone bodies
abh00280  Valine, leucine and isoleucine degradation
abh00310  Lysine degradation
abh00362  Benzoate degradation
abh00380  Tryptophan metabolism
abh00620  Pyruvate metabolism
abh00630  Glyoxylate and dicarboxylate metabolism
abh00640  Propanoate metabolism
abh00650  Butanoate metabolism
abh00900  Terpenoid backbone biosynthesis
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01200  Carbon metabolism
abh01212  Fatty acid metabolism
abh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M3Q_3329
   00630 Glyoxylate and dicarboxylate metabolism
    M3Q_3329
   00640 Propanoate metabolism
    M3Q_3329
   00650 Butanoate metabolism
    M3Q_3329
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M3Q_3329
   00072 Synthesis and degradation of ketone bodies
    M3Q_3329
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M3Q_3329
   00310 Lysine degradation
    M3Q_3329
   00380 Tryptophan metabolism
    M3Q_3329
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M3Q_3329
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M3Q_3329
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M3Q_3329
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abh04147]
    M3Q_3329
Enzymes [BR:abh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M3Q_3329
Exosome [BR:abh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M3Q_3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N
Motif
Other DBs
NCBI-ProteinID: AFU39414
Position
3567115..3568290
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQPTDVEEVIMGCVLPAG
LKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSAEIVVAGGMESMTN
APYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKRAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNAKIDKIPSLKPAFAKDGTI
TAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNSQHPSEFTIAPVGAIEKVLK
KAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGVAALCIGGGEATAVAIEIL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtaattgttaatggtgctcgtactgctatgggtggttttcaaggatca
ctatcaggactaactgctcctgaattaggagcagtaacaattaaagaagcaatcgcacga
gcaggtttacagcctacagatgtcgaagaagtcattatgggttgcgtactaccagcgggt
ttaaagcaaggccctgctcgtcaagccatgcgtaaagcaggtttacctgattcaacagga
gctgtgacaattaataagctttgtggttcaggtatgaaggcggtaatgcaagcggctgat
atgattaaagcaggaagtgctgaaattgtagttgccggtggtatggagtcgatgaccaat
gcgccttatgtcttacccaaagcacgtgcgggataccgtatgggccacggtgaaattaaa
gaccatatgttctttgatggcttagaagatgctgaaactggacgtttaatgggttcattt
gctcaagatatggcaaatacacgtggttatactcgtgagcaaatggatgactttgcaatt
cgttctttaaaacgtgctcaaactgcgattactgaaggctatttcaaagatgaaattgta
cctgttactgtttctacccgtaaaggtgatgtcattgtcgatcaggatgaacaaccctta
aatgccaagattgataaaatcccatcccttaaaccagcttttgcaaaagacggtaccatt
actgctgcaaacgcgagttcaatttctgatggtgcttctgcactagttttaacatcgagt
gaagttgcagcacagcgcggcttacaaccacttgcaaaaatcatagccactgcgtcaaat
tctcaacatccttcagaatttacaattgctcctgttggcgctattgaaaaagtacttaaa
aaagcaggttggaatgctcaggacgttgacctttgggaaattaatgaagcttttgctatg
gtaacgatgtgtccaattgatgatttcaaacttgatccagaaaaagtcaatattcatggt
ggagcatgtgcacttggtcatcctgtaggatcgacaggctctcgtattattcttacgctt
attcatgcgcttaaacgtactggtggtaaaaagggtgtcgctgctctttgcatcggcggt
ggggaagcaacagctgttgccatcgaaattctttaa

DBGET integrated database retrieval system