KEGG   Aciduliprofundum boonei: Aboo_0219Help
Entry
Aboo_0219         CDS       T01180                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
abi  Aciduliprofundum boonei
Brite
Enzymes [BR:abi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Aboo_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_3 Methyltransf_23 Methyltransf_25 Methyltransf_11 CMAS Methyltransf_18 Methyltransf_31 GCD14 SAM_MT
Motif
Other DBs
NCBI-ProteinID: ADD08031
UniProt: B5IHE0
Position
complement(225969..226604)
Genome map
AA seq 211 aa AA seqDB search
MNNEHMVETLAMYGYIKSERIKEAFLKVDRANFVPEEYRDKAYFDDPLPIGHAQTISAPS
MVAIMLELLELFEGAKVLEIGTGSGYNACLMACAGAEVYTIERIPALRDMAKKNMEKCPC
RSKVRILLGDGSGGYEAEAPYDRIIVTCGAPDVPSPLIEQLKIGGIMVIPIGGTFFQELY
VIKKERNGLKKRVWGDVAFVPMVGKYGHRWA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatgagcatatggttgagacattggcgatgtacgggtacataaaaagtgagaga
ataaaagaagccttcttgaaggtggacagggcgaattttgtgcctgaggagtatagggat
aaagcgtattttgacgatcctttgcccatagggcatgcccagaccataagtgcgccaagt
atggttgcaataatgcttgaattactggaattatttgaaggagctaaagtcctggagata
ggcacgggctctggctataatgcctgtcttatggcatgcgctggagctgaggtttacacc
atagagagaatacctgcgctgagagatatggcaaaaaagaatatggagaaatgtccttgc
aggtccaaggtaagaattttgctcggcgatggctctggtggatatgaagccgaagcgcct
tacgataggataattgtaacctgcggagctccagatgtaccttctcctctgatagagcaa
ttgaaaatcgggggcataatggtaattcccataggcggaacattttttcaagagttgtat
gtgataaagaaagagagaaatggtttaaaaaagagagtttggggagatgtggcctttgta
cctatggtgggtaaatatggtcataggtgggcttag

DBGET integrated database retrieval system