KEGG   Aciduliprofundum boonei: Aboo_0431Help
Entry
Aboo_0431         CDS       T01180                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00010  Glycolysis / Gluconeogenesis
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
abi01200  Carbon metabolism
abi01230  Biosynthesis of amino acids
Module
abi_M00002  Glycolysis, core module involving three-carbon compounds
abi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
abi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_0431
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Aboo_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ADD08242
UniProt: B5IAB7
Position
complement(427743..428741)
Genome map
AA seq 332 aa AA seqDB search
MVRVAINGFGRIGRLVFRIGHRDLDIVAINDITDARTLAHLLKYDTNYGKFDGEVEYTEK
SLIINGREIPVFSERDPEKLPWKELGVDIVIESTGVFRSRDKAAKHLKAGARKVIITAPS
KGEPADVTIVLGVNQDKYDPEKHDVISNASCTTNCLAPVAKVLHENFGIKYALMSTVHSY
TNDQRVLDLPHRDLRRARAAAMNIIPTTTGAAKAIGLVIPELDGKMHGISIRVPTSTVSI
VDLVAEVEKEPTEEEVREAFKKAAEGELKGILQYVDEPLVSVDFKGNPHSAMYDALETYV
RGNLVKVLAWYDNEYGYSARVVDLVKYISQWL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgtagctataaatggttttggacgcatagggcgcttggtttttcgcatagga
catagggatctggatattgtggcaataaacgatataacggatgcacgcactctagcacat
ctcctaaagtacgataccaattatggaaaatttgatggagaggtggagtacactgaaaaa
agcttgattataaatggccgcgaaattccagttttcagcgagagggacccggaaaaactg
ccttggaaagaattgggagtggatatcgttatagagagcacgggagtatttcgctctaga
gataaggcggcaaagcatctaaaagcaggagcaaggaaggtgataataactgcaccatca
aagggagagccagcggatgttaccatagttctcggagtgaatcaggataagtatgacccg
gaaaagcatgatgtgataagcaacgcctcttgcaccaccaattgtttggcgcctgtggca
aaggtgctgcacgagaattttggaatcaagtatgccttgatgtccaccgtacattcctat
accaatgaccagcgtgttttagatttacctcatagagatttgcgcagggctagagcggca
gcaatgaatattatacccacaaccacgggggcagccaaggcaatagggcttgtaatacca
gaacttgatggaaagatgcatggcatatcaattcgtgtgcccacaagcacggtttccata
gtggatctcgtggctgaagttgaaaaggagcccacggaggaggaagtgagagaggccttc
aagaaggctgctgagggtgagttaaaagggatattgcagtatgttgatgagcccctcgtt
tccgtggatttcaaggggaatccgcatagcgctatgtatgatgctcttgaaacctatgtt
cgcgggaatcttgtgaaggttcttgcatggtatgataacgagtatggctattcggccagg
gttgtggacttggtgaagtacatatctcaatggctgtaa

DBGET integrated database retrieval system