KEGG   Aciduliprofundum boonei: Aboo_0578Help
Entry
Aboo_0578         CDS       T01180                                 

Definition
(GenBank) geranylgeranyl reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Aboo_0578
Enzymes [BR:abi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Aboo_0578
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Aboo_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_oxidored FAD_binding_2 Trp_halogenase DAO Lycopene_cycl Pyr_redox_2 NAD_binding_8 HI0933_like GIDA Thi4 Pyr_redox 3HCDH_N AlaDh_PNT_C Myosin_N SE Pyr_redox_3 MSP
Motif
Other DBs
NCBI-ProteinID: ADD08389
UniProt: B5I9X8
Position
complement(559764..560951)
Genome map
AA seq 395 aa AA seqDB search
MKRYEYDVLVIGAGPGGSMAARYAARHGLKVLLIEKRPEIGVPVRCAEGISRAWMDEVEI
EPQEKWIDAEIDGAKIYSPDEKSVIKLSAEQAGNEVGFVLNREYFDKYLASLAAQEGAEI
WLKSPAVEIIKEDGYVRGAIVRRFGEKVEVRAKIVIGADGFESQVARWAGLNTVLRERDI
VSCIQYRMTNIDIEENFTHFFIGSCAPGGYVWIFPKGRKEANVGIGVALNKLKSKGEVKK
YMDDFIEKHEYLNKGSIIQIVTGAVSTCPVPKRIVDNGIMLVGDAARLIDPITGGGIANA
CISGKYAGEIAAKCINNPSKECLEEYQNKVKERWEKKHLRNWFVKEKLAELSDDTLNKLM
DVVSKEDISEISVRAILEAVQKKYPELIEEFEDLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatacgagtatgatgtcttggtgataggggccggtcctgggggaagcatggct
gctaggtacgcagctcgccatggactcaaagtattgttaatagagaaaagaccggagata
ggagtgcccgtgcgctgcgccgaaggtatatcgagagcatggatggacgaggttgaaatt
gaaccacaagaaaaatggatagatgctgaaatagacggtgcaaaaatatattcacccgat
gaaaagagtgtaataaaactatctgccgagcaggctggaaacgaagttggattcgttttg
aatcgtgagtactttgataagtacctcgcatccttggcagcgcaggaaggagcagaaatc
tggctaaagagccccgcggtggagataataaaagaagatggctatgttcgtggagcgatt
gtgagaagattcggtgagaaagttgaggttcgtgcaaaaatagttattggtgccgatggc
ttcgaatctcaagttgctagatgggcaggattaaacactgtgctgagggaaagggatata
gtctcttgcatccagtacaggatgacgaatatagacattgaagagaattttacccatttc
ttcatcggctcttgcgcccccggtggctatgtctggattttccccaagggaagaaaggag
gcaaatgtaggcatcggtgtggctttaaacaagttaaaaagcaagggagaggtgaagaag
tacatggatgatttcatagaaaagcatgagtacctcaataaagggagcataatacagata
gttacgggcgcagtatccacttgccctgtgcctaagagaatagtggataacggtataatg
ctcgttggagatgcggctaggctaatagatccgataacaggaggaggtatagcaaatgcc
tgtatatccggcaaatatgctggggagatagccgccaagtgcataaacaatcctagcaaa
gagtgcttagaagagtatcagaacaaagtgaaggagagatgggaaaagaaacatctacgc
aattggttcgttaaagagaagcttgcagagctaagcgatgatacattaaataagctcatg
gatgttgtttcaaaagaagatattagcgaaatatcagtaagggccatactcgaagctgta
cagaagaaatatccagagcttattgaagagtttgaagaccttctataa

DBGET integrated database retrieval system