KEGG   Aciduliprofundum boonei: Aboo_0986Help
Entry
Aboo_0986         CDS       T01180                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00020  Citrate cycle (TCA cycle)
abi00640  Propanoate metabolism
abi00660  C5-Branched dibasic acid metabolism
abi00720  Carbon fixation pathways in prokaryotes
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
abi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aboo_0986
   00640 Propanoate metabolism
    Aboo_0986
   00660 C5-Branched dibasic acid metabolism
    Aboo_0986
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Aboo_0986
Enzymes [BR:abi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aboo_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA GARS_A ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADD08795
UniProt: D3T9L6
Position
951508..952614
Genome map
AA seq 368 aa AA seqDB search
MNLYEYQGKALFRKFGVPTPEGYVAFKPEDIKEFEGERVIKAQVLTGGRGKSGGVKFASS
LEEARELARQILAMEIKGHKVHAVLVEEKLKIEKEFYVSILIDRSTRSPLIMASPEGGVE
IESVPDEKIYKFVVNPEIGVQPFVGRLLSKKMGFTGDLAKQFTKILMNLYHMFREYDAEL
VEINPLVLSEGKLIAADSKVVIDTDSLYRHKDLEENAEEKTPLELEANKAGYAFVELDGN
VGVIANGAGLTMATLDTLLLYGLKPRNFLDLGGTDSVDITKNAFTYVLKANPDAILVNIF
GGVTKCDTVAQGIIAAKDAFNINLPIVVRLSGVHEEEGRKMLEEKGIHAFADMRHAIEKL
KSIMEGSQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtacgaatatcaaggaaaagcactctttagaaaatttggagtgccaacgcct
gagggctatgtagccttcaagccagaggatatcaaagagtttgagggagaaagagtgata
aaagcgcaagttctgacaggcggcaggggcaagagtggaggcgtgaagtttgcctccagt
ttagaagaggctcgagagcttgctcgacagatacttgccatggagatcaagggccacaaa
gtacacgcagttctcgtggaggagaagttgaagattgagaaagagttctatgttagtata
ttgatagatagaagtactagaagcccgctcataatggcatctcctgagggaggtgtagag
atagagagtgtacctgatgagaagatttacaagttcgttgtaaatcctgagattggtgta
cagccatttgtgggtagattgctctctaagaaaatgggctttactggagatctggccaag
caattcaccaagattctaatgaatctctaccacatgttccgcgagtacgatgcagagctg
gttgaaatcaatcccctcgttctgagcgagggaaagttaattgctgcggactctaaggtg
gtaatagatacagactccctatacaggcacaaggaccttgaggagaacgcagaggagaaa
actccgctggaattagaggcaaacaaagcgggatatgctttcgttgaattagatggtaat
gtgggagtcatagccaacggtgcaggattaaccatggccacgctggatactttgctttta
tatgggctgaagcccagaaacttcttggatttgggcggcacagatagcgtggatataaca
aagaacgctttcacttatgtgcttaaagcaaatcctgatgcgattctagttaacatattc
ggtggcgttacgaaatgcgacaccgttgcacagggtataatagcggctaaagatgctttc
aatatcaacttgcccatagttgtgcgcttgagcggcgtgcatgaagaagaaggccgcaag
atgcttgaagaaaagggcatacatgcatttgcagatatgcgccatgctattgagaagctt
aaatctattatggagggatcgcaatga

DBGET integrated database retrieval system