KEGG   Aciduliprofundum boonei: Aboo_1184Help
Entry
Aboo_1184         CDS       T01180                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIA
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00627  Aminobenzoate degradation
abi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Aboo_1184
Enzymes [BR:abi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     Aboo_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase PGP_phosphatase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ADD08993
UniProt: D3TA64
Position
1133311..1134078
Genome map
AA seq 255 aa AA seqDB search
MHMKFVIDMDGVLYRGNRKIEGADTFIKFLQDNSVPFLLATNNSTKTREMYVEKLKNMGI
KVKEKNIITSAYVTAEVLKKEENRASALIIGEIGIFEEIKRIGWGILDLKNWSKAEYVIV
GMDTTLTYEKLKAGCLAINNGAKFIATNDDKNFPSEEGLIPGAGSMVAALEAATGKKARV
MGKPNEPYVNMIKSLLGSEDIWVVGDRIETDMLLAEKLGAKKVLVLSGVTKEPVKNVDYV
INDVGRLPALLASIL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgaaattcgtaatagacatggatggcgtgctttatcgggggaatagaaaaata
gagggtgcggatactttcataaaattcttacaggataatagcgtcccctttcttctcgcc
actaacaattccacaaaaacaagagagatgtatgtggaaaaactaaaaaatatgggaata
aaagtaaaagagaagaatatcataacatccgcctatgtgacggcagaagttctaaaaaaa
gaggaaaatagagcttctgcactcataattggtgagataggaatattcgaagagataaag
agaattggatggggcatccttgatttaaaaaattggagcaaagcggaatatgttatagta
ggcatggatactaccttaacttacgagaagctaaaggcaggatgtttggccataaataac
ggggcaaaattcattgccacgaatgatgacaaaaatttcccgtcagaggaggggctgatt
cccggagcagggagtatggtggccgccttggaagcagcaacgggaaaaaaagccagagtt
atgggaaagcccaatgagccctatgtgaatatgataaaatccttactaggaagtgaagat
atatgggttgtaggtgatagaattgagactgatatgcttctcgcagaaaaattaggagca
aaaaaagtactagtgctgagcggtgttacaaaagaacccgtaaaaaatgtggattatgtt
ataaatgatgtgggcaggctcccagccctgcttgcttctattctctga

DBGET integrated database retrieval system