KEGG   Aciduliprofundum boonei: Aboo_1538Help
Entry
Aboo_1538         CDS       T01180                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00010  Glycolysis / Gluconeogenesis
abi00030  Pentose phosphate pathway
abi00051  Fructose and mannose metabolism
abi00052  Galactose metabolism
abi00230  Purine metabolism
abi00500  Starch and sucrose metabolism
abi00520  Amino sugar and nucleotide sugar metabolism
abi00521  Streptomycin biosynthesis
abi01100  Metabolic pathways
abi01110  Biosynthesis of secondary metabolites
abi01120  Microbial metabolism in diverse environments
abi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aboo_1538
   00030 Pentose phosphate pathway
    Aboo_1538
   00051 Fructose and mannose metabolism
    Aboo_1538
   00052 Galactose metabolism
    Aboo_1538
   00500 Starch and sucrose metabolism
    Aboo_1538
   00520 Amino sugar and nucleotide sugar metabolism
    Aboo_1538
  Nucleotide metabolism
   00230 Purine metabolism
    Aboo_1538
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aboo_1538
Enzymes [BR:abi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Aboo_1538
    5.4.2.8  phosphomannomutase
     Aboo_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADD09344
UniProt: D3TB65
Position
1470347..1471699
Genome map
AA seq 450 aa AA seqDB search
MRLFGTNGIRGKIGEEFTPDFLVNVGRAIGTYLPLGSDVILGTDTRVSANMVKDAVISGL
LSAGVNVIDIGIAPTPAIQLYTKRHGDFGIAITASHNPPEFNGVKAIASDGTELPRSEEE
KIEEIYFSGQFRNVEWNNVGSYEIREDANEEYVNSILSLVDTNRIKEKHFKVVLDCANGA
SCFTSPYLLEKLGCKVISLNCQPDGRFPGHNSEPKPENLKDLVDMVKATNADLGIAHDGD
ADRAIFVDDRGRYLYGDKTLALVAKEIVKERKGIVVTPVSSSLALEDVVKKEGGEVVYTK
VGAPIVARKMIELHAIFGGEENGGLIFPEHQYCRDGAMALAKILEILAKKEKKLSELADE
LPKYKQMKISVACENEKKEKVLEELKKRVMGENVNTLDGIKIMGKDWWVLIRPSGTEPIY
RIYAEAKDENILKKKVEKYKEILKNIIKSE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttattcggcacaaacggaattcgaggcaagattggcgaagagttcactccggat
ttcttggttaatgtaggccgtgcaattggaacatatttgccccttggctcagatgtgata
cttggaacagatacaagggtttctgcaaatatggtgaaagatgctgtaatatccggactt
ctttcagcaggggtaaatgttatagacataggtatagctccaactcccgcaatacaactc
tacacaaagagacatggggattttggaatcgccataactgcaagtcataatcctccagaa
ttcaatggagtaaaggcgatagcttcagatggaacagaactgccaaggagcgaggaggag
aaaatagaggaaatatatttctcaggccaattcagaaatgtggaatggaataatgttggg
agttatgaaataagagaagatgcaaatgaggagtatgtaaattccattctttccctagtt
gatacgaataggataaaagaaaagcacttcaaggtggtacttgattgcgcaaatggtgct
tcctgctttacatctccatatctcctcgaaaagcttgggtgcaaggtaatatcactaaat
tgccagccagatggcaggttccctgggcacaacagcgagccaaaaccagaaaacttgaaa
gaccttgtggatatggttaaggctacaaatgcagatttaggaatagctcatgatggggat
gctgaccgtgccatatttgtagatgatagaggaagatacctgtatggggataaaaccttg
gccttagttgcaaaggagattgtaaaggaaagaaagggtattgtagtaactccagtgagc
tcctctctggctcttgaagatgttgttaagaaggaggggggagaggtagtgtatacaaaa
gtaggcgctccaatagtggcaaggaagatgattgaacttcatgcaattttcggtggagag
gagaacggtggactaatattcccagagcatcagtactgcagagatggagcaatggcctta
gctaagattcttgaaatcttggcaaagaaagagaaaaaattgagtgaacttgcagacgaa
cttccaaaatataagcagatgaaaataagtgtggcatgtgagaacgagaaaaaagagaaa
gtgctggaagaattgaaaaaaagagtaatgggagagaatgtaaatacattggacgggata
aaaattatgggtaaggactggtgggttttaatccgcccctcaggtacggagccaatttac
aggatttatgcagaggcaaaggatgaaaatattttaaagaagaaagttgagaagtataaa
gaaatattaaaaaacataataaaaagtgagtaa

DBGET integrated database retrieval system