KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_00080Help
Entry
BJAB07104_00080   CDS       T02726                                 

Definition
(GenBank) Phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
abj00562  Inositol phosphate metabolism
abj00564  Glycerophospholipid metabolism
abj00565  Ether lipid metabolism
abj01100  Metabolic pathways
abj01110  Biosynthesis of secondary metabolites
abj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:abj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BJAB07104_00080
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BJAB07104_00080
   00565 Ether lipid metabolism
    BJAB07104_00080
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BJAB07104_00080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:abj02042]
    BJAB07104_00080
Enzymes [BR:abj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BJAB07104_00080
Bacterial toxins [BR:abj02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BJAB07104_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: AGQ12451
Position
86394..88562
Genome map
AA seq 722 aa AA seqDB search
MNRREFLLNSTKTMFGTAALASFPLSIQKALAIDAKVESGTIQDVKHIVILTQENRSFDN
YFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLDSRLGNAQRVTGTNHSWSD
GQGAWDNGRMSDWVAHKQPQSMGYYKKQEVEYQFALANAFTICDAYHCAMHAGTNPNRKF
IWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPERLQQAGVTWKVYQNMPDNFTDNP
LAGFKQYRRANEQSGQPVSNDTLICPAYDEKIDATQPLYKGIANTMPDGGFLGAFKADIA
QGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQEVLNALTENTQVWSQTVLLVNFDENDG
FFDHVPSPSAPSKDINGVVYGKTTLTDQQVSYEYFNHPAVATSKSQPETDGRVYGPGVRV
PMYVISPWSRGGWVNSQVFDHTSILQFLEKRFGVQEPNISPYRRAVCGDLTTAFNFKTPN
HLPVAELDGKKTKAEADAIRVAQELLPQVSVPSQQQFPQQEIGIRPSRALPYILHTSAKV
DATQKTVKLMFSNTGKQAAVFHVYNRLDLTAIPRRYMVEAGKQLDDVWNTINGQYDLWVL
GPNGFHRAFKGNLSQANQTQALPEIRVCVEECDANLYLKVRHDGNKTVKLNVKANAYLPN
KTWAIETNSVEKELVWDMSEFGGWYDFTVTLADDATFSRRFAGRIETQEDSISDPYMGYL
ES
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcgcgaatttcttttaaattctacaaaaacaatgtttgggacagctgctcta
gcgagtttcccgctgagtattcaaaaagcgttagcaattgacgccaaagttgaaagtgga
acaattcaagatgttaaacacattgtgattttgactcaggaaaaccgttcatttgataat
tattttggaacactaaaaggtgtacgtggtttcggcgaccgttttaccattcctatgaca
gaaggtcgaaaggtttgggaacaatatgacgccaacaaaaagaaagtattgccataccac
ttagatagtcgtttaggaaatgctcagcgtgttactggtacaaatcattcatggtcagat
ggtcaaggtgcttgggataatgggcgtatgagtgattgggtagcgcataaacaaccgcag
tcgatgggctactacaaaaaacaagaagttgaatatcaatttgccttagcgaatgctttt
acgatttgtgatgcctaccactgtgccatgcacgcgggaactaacccgaaccgtaaattt
atctggacgggaaccaatggccctacaggtgcaggtgttgcgagtgtggtcaatgaattt
gatgggattggaccatcaacagaaggttatgaatggacgacatatcctgagcgtttacag
caggccggcgtgacatggaaagtttatcaaaacatgccggataactttactgataaccct
ttagctggtttcaagcaatatcgccgtgcaaatgagcaatctggtcagcctgttagtaac
gatacgctcatttgtccagcatatgatgaaaagattgatgcgactcaaccactttacaaa
ggtattgccaataccatgccggacggtggttttctaggagcttttaaagctgatattgcg
caaggtaaattaccgcaagtgagttggttagttgctcctgcaacttacagtgaacatccg
gggccatctagtcctgtacaaggcgcttggtatattcaggaagtattaaatgcattaact
gaaaacactcaagtgtggagccaaaccgttttattggtgaacttcgatgaaaatgacggt
ttctttgaccatgttccttcaccaagcgcaccttctaaagatataaacggtgttgtatat
ggaaaaaccactttaacggaccaacaagtatcttatgaatactttaaccatccagcagtg
gcgacttcaaaatctcaacccgaaacagacggacgggtgtatggcccaggtgtacgcgtt
ccaatgtatgtgatttcgccgtggagccgtggaggatgggtaaattctcaagtctttgat
catacttctattttacaattcttagaaaaacgttttggtgtgcaagaacctaacattagc
ccataccgccgtgctgtatgtggtgatttaacaacggcatttaattttaaaacaccgaat
catttgcctgttgctgaactagatgggaagaaaacaaaagccgaagccgatgcgattcgt
gtcgctcaagaactattgccgcaagtttctgttccgagccagcaacaatttcctcagcag
gaaataggaattcgaccttcgcgtgctttaccttatattttgcacactagtgccaaagtc
gatgccactcaaaaaacggttaagctgatgttctccaatacgggtaaacaggcagccgtt
ttccatgtctataaccgattagatcttacggcaattccacgccgctatatggttgaggcg
ggcaaacagcttgatgacgtgtggaatactatcaatggacagtatgatttatgggtcctt
ggaccaaatggttttcaccgtgcgtttaaaggtaatttaagtcaagctaatcagactcaa
gcattaccggaaattagagtatgtgtagaagaatgtgatgcgaatttatatttaaaagtg
cgtcatgatggtaataagacagtcaagctcaacgtcaaagctaatgcttatctaccaaac
aagacatgggcgatagaaaccaatagtgttgaaaaagaactggtttgggatatgtctgaa
tttggtggttggtatgattttacggtgacattagcggatgatgcgacatttagtcgccgt
tttgcaggacgtatagaaactcaagaagattcaatttctgatccatatatgggatattta
gagtcttaa

DBGET integrated database retrieval system