KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_01070Help
Entry
BJAB07104_01070   CDS       T02726                                 

Definition
(GenBank) Phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abj  Acinetobacter baumannii BJAB07104
Brite
KEGG Orthology (KO) [BR:abj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJAB07104_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGQ13438
Position
1154626..1156161
Genome map
AA seq 511 aa AA seqDB search
MPVFLTIIIATLIYIGFQVSADLAHVPPLSLYSVILLSTALLIALGFEFVNGFHDTANAV
ATVIYTNALPAPVAVMWAGFCNFLGVMVASGAVAYGIIALLPVELIMNMGSGAGFAMVFA
LLIAAILWNLGTWFLGIPASSSHTLIGSILGVGIMNHLLSASTGVTTSGVDMDQVIKVGK
ALLFSPLIGFAFAAIVFLLVKTIFKRQLELFQPPEGNKPPPAIIRAILIFTCTGVSFAHG
SNDGQKGMGLIMLILVGLVPLAYSLNKNLDTQQVQSFHQLSSQTAVLLNQNQPELTDEKA
RAVLTKYIQTKQQTPEVVPALASMTDHLGERVSSYSNLKDIPEAAISEIRNDMYLSTTTF
KRLDKADALPKMDDSQKKLVKDYRSSLDSFLQYIPNWVKVAVALALGLGTMVGWKRIVVT
VGERIGKHHMTYGQGMSAELVAMSTIAAADGLGMPVSTTHVLNSAVAGTMVANKSGLNFN
TVKTILSAWVFTLPATICLSGGLYWLFLQFV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgtttctgacgattattattgcaacacttatttatattgggtttcaggtcagt
gctgatttagcgcatgttccacctttaagcctttattcagttattcttttatctactgca
ctcttgattgcactaggctttgaatttgtaaacggtttccatgacactgctaatgcagtt
gcaacggttatttatacaaatgctttgcctgcaccggttgcagtcatgtgggcaggtttt
tgtaatttccttggggtaatggtcgcaagtggtgctgttgcgtatggcattattgcattg
cttccagttgaacttattatgaacatgggcagtggtgctggctttgcaatggtttttgca
ttgttgatcgctgcaattctttggaatcttggtacttggttcttgggaattcctgcttct
agctctcataccttgattggttcaatcttaggtgtgggtattatgaatcatctgttgagt
gcatcgactggcgtaacgaccagtggtgttgatatggatcaggtgattaaagtaggtaag
gcattattattttctcctttaattggttttgcttttgcggcaattgtattcttgttggtt
aaaactattttcaaacgccaattagaattattccagccacctgaaggaaataagccacca
ccagcaatcattcgcgcaattcttatctttacctgtacaggtgtgagttttgcacatggt
tctaatgatggccaaaaaggtatgggtcttatcatgctgattttggttggtttggtgcca
ttagcttattcattaaataaaaacctcgatacacagcaggttcaatcattccatcagctt
tcttctcaaactgcggttttgttaaaccaaaatcaaccagaattgactgacgaaaaagcg
cgtgcggttttaactaaatacattcaaaccaagcaacaaacgcctgaagttgtgcctgca
ttggcaagcatgactgaccatttgggtgagcgtgtttctagctatagcaacttaaaagat
attccagaagctgcaattagcgaaatccgtaatgacatgtatttgagcacaacgacgttt
aagcgtttggataaggcagatgctttaccaaaaatggatgactcacagaaaaagcttgtg
aaagattatcgtagtagcttggattcattcttacaatacattccaaactgggtgaaagtg
gcggtcgcattagcgcttggacttggtactatggttggctggaaacgtattgtggtaact
gtcggtgagcgtattggtaagcatcacatgacttatggtcaagggatgtctgctgagctt
gttgcaatgagtacaattgctgcagcagatggtttaggtatgccggtttcaacaacacac
gttttaaacagcgctgttgcaggtactatggttgccaataaatcaggcctgaatttcaat
actgtaaaaacaattctctctgcatgggtatttacacttcctgcaaccatctgtttgtcg
ggtggtttgtactggttattcttacagtttgtataa

DBGET integrated database retrieval system