KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_01460Help
Entry
BJAB07104_01460   CDS       T02726                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
abj  Acinetobacter baumannii BJAB07104
Brite
KEGG Orthology (KO) [BR:abj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abj02044]
    BJAB07104_01460
Secretion system [BR:abj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB07104_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AGQ13828
Position
1533174..1534655
Genome map
AA seq 493 aa AA seqDB search
MNNTQSAAMPLVENEEVNLLDSIVEQSRIARNEEEHSRAKSLIGELAKEVMAGTITVSEN
MTLSIDKRIAEIDALISKQLSQIMHNEQFQKIESTWRGLYYFCQETPSNPLIKIRMLNTT
KKELVKDFQGATDFDQSTLFKKIYEEEYGSFGGAPYSALIGDFEFDRTPSDMYLLEQISH
VAAAAHAPFISAASPSILGLESFTDIDRPRDVSKIFETAEYVQWRSFRDSEDSRYVALTL
PHVLGRLPYHPKEGTATEGFNFIEDVSGENHNEYLWMNAAYAFGTRLTNAFDMHGWCAAI
RGVEGGGLVEGLPVHTFKTQDGEVVFKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAA
FFGAQSTQKPKKYDNDTANANSALSSQIQYIMAVSRIAHYLKAMMRDKVGSFASAGNVEA
FLNEWLSQYVLLDDGASQEAKAQYPLREASVKVVEDPAQPGHYKSVVFLRPHFQLDELSV
SLRLVTELPQSSN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaataatactcaatcagcagcaatgccacttgttgaaaatgaagaagttaatctttta
gattcgattgttgaacaaagccgtattgcacgaaatgaagaagaacattctcgtgctaaa
agcttaattggtgagcttgctaaagaagtaatggcagggaccattactgtttctgaaaat
atgactttatcaattgataagcgtattgcagaaattgatgctctgatttcaaagcagtta
agtcagatcatgcacaatgaacaattccaaaaaattgagtcaacttggcgtggtctttat
tacttttgtcaggaaacgccttcaaatccgctcattaaaattcgtatgcttaatacgact
aagaaagagttggtaaaagatttccaaggtgctacagactttgatcaaagcactttgttt
aagaaaatctacgaagaagaatacggttcttttggtggtgcaccatactcagcattaatt
ggtgattttgagtttgatcgtactccatctgatatgtatttgcttgagcaaatctctcat
gttgcagcggcagcacatgcaccatttatttcagctgctagtccgagcattttaggcctt
gaatcatttacagatattgatcgtcctagagatgtttcaaaaatctttgaaaccgctgaa
tatgttcaatggcgttcgttccgtgatagtgaagactcacgttatgttgcattgactttg
cctcatgtcttgggtcgtctcccatatcatccaaaagaaggtactgcgacagaaggcttt
aattttattgaagatgtttctggtgaaaaccacaatgaatatttgtggatgaatgcagct
tatgcttttggtactcgcttaacaaatgcatttgatatgcatggttggtgtgctgctatt
cgcggtgttgaaggtggtggtttagttgaaggcttgccagtacatacttttaaaacacaa
gatggcgaagtggtattcaagtgtccaactgaaattgcaatcacggatcgccgtgaaaaa
gagttaagcgatctaggcttcattccgttagtacattgtaaaaatacagattacgcagct
ttctttggcgcgcaatcaactcaaaaacctaaaaaatatgacaatgatacagccaatgca
aactcggctttatcaagtcagattcagtacatcatggctgtttcacgtattgcacattac
ttaaaagcaatgatgcgagataaagtgggtagctttgcttctgctggaaatgttgaagca
ttcttaaatgagtggttgtcacagtatgtcttacttgacgatggtgcttctcaagaagca
aaagctcaatacccgttacgtgaagcgtctgtaaaagttgtagaagatcctgctcaacca
ggtcactacaaatctgtggttttcttgcgaccacatttccagctggatgagttgtcggtt
tctttacgacttgtcactgagttacctcagtcctcaaattaa

DBGET integrated database retrieval system