KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_01527Help
Entry
BJAB07104_01527   CDS       T02726                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K23463  (Z)-2-((N-methylformamido)methylene)-5-hydroxybutyrolactone dehydrogenase [EC:1.2.1.-]
Organism
abj  Acinetobacter baumannii BJAB07104
Brite
KEGG Orthology (KO) [BR:abj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJAB07104_01527
Enzymes [BR:abj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BJAB07104_01527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AGQ13895
Position
1603830..1605299
Genome map
AA seq 489 aa AA seqDB search
MTADFQLYINGQFESGAATFESINPATGEVWAHMPEARTDEVNRAVQAASQALKAPEWAG
LTASQRGKLLYKLADLIEKAAPQLAQIETSDTGKIIRETSSQIAYVAEYYRYYAGIADKL
EGSFLPIDKADMQAWIVREPVGVVAAIVPWNSQLFLSAVKVGPALAAGCTVVLKASEDGP
GPLLAFAKLVHEAGFPAGVVNVITGFGPECGAVLSSHPDVAHVAFTGGPETARHIVRNSA
ENLAKVSLELGGKSPFIVFADADIQSAVNAQVAAIFAATGQSCVAGSRLLVEESIKDEFV
QRLVERVQTIKIGLPHEMATEFGPLCTLRQRQKIEQVIASSIQQGAKLLTGGKSIERAGY
YYPPTILDCTDAPQADCITTELFGPVLSVDSFKDEAEAVQKANSTPYGLAAGVFTTNLSR
AHRMTKVIGSGIVWLNTYRAVSPLAPFGGHGLSGHGREGGANAVLDYTTTKTVWLRTSDE
PIDDPFVMR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagattttcagctttatattaatggtcagtttgaatctggtgcagcgacgttt
gaaagtattaatcctgcaacaggtgaagtttgggcacacatgccggaagctcgaaccgat
gaagtcaaccgagcagttcaagcggcatctcaggcgttaaaagcaccggagtgggcaggt
ttaacggcctcccagcgcggtaaattgctctataagttggctgatttaattgaaaaagct
gcaccgcaacttgcccaaattgaaaccagtgatacgggcaagattattcgtgaaacatcg
agccagattgcctatgtcgctgaatattatcgctactatgcaggtattgccgacaaatta
gagggtagttttctaccgattgataaggcagacatgcaagcatggattgttcgtgaacca
gtaggtgtggttgctgcaattgttccttggaacagtcagttatttttatcggcagtgaag
gtagggccagctttagcagcaggttgtacggtcgtgctaaaagcttctgaagacggccct
ggaccattgttagcctttgccaaattagtccatgaagcgggttttccggctggagtggtc
aacgtgattaccggtttcggacctgaatgtggcgccgtgctgagtagtcatccggacgtt
gctcatgttgcgtttacaggtggtccagaaacggcaaggcacattgtgcgtaactcggct
gaaaatcttgcaaaagtttcactcgaattaggtggcaaatcaccatttattgtatttgct
gatgcagatattcaaagtgcggtaaatgctcaggtcgctgctatttttgcggccacaggg
cagagttgtgtagcaggttcacgtttactggttgaagaaagcattaaagatgaatttgtt
cagcgtttggttgagcgtgtacaaaccataaaaattggtttacctcatgagatggcaacc
gagtttggaccactttgtaccttacgccaacgccaaaaaattgagcaagtcattgcaagc
tcaatccagcaaggtgcaaaacttcttactggtggtaaaagcattgagcgagcagggtat
tactatccaccgaccattttagattgcaccgatgcacctcaagcagattgcattaccacg
gaattatttggtccggtgttatcggtagatagtttcaaagatgaagcggaagctgtgcaa
aaagccaatagtacgccttacgggctggcagcaggcgtttttaccaccaatttaagccgt
gctcaccgtatgaccaaagtcattgggtcgggaattgtttggttaaatacttaccgcgcg
gtttctccacttgcgccttttggtggacatgggctttcgggacatgggcgggaaggtggc
gcaaatgctgttttagattacaccaccaccaaaacagtttggttacgtacctcagatgag
ccaattgatgacccatttgtcatgagataa

DBGET integrated database retrieval system