KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02252Help
Entry
BJAB07104_02252   CDS       T02726                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
abj00220  Arginine biosynthesis
abj00250  Alanine, aspartate and glutamate metabolism
abj00290  Valine, leucine and isoleucine biosynthesis
abj01100  Metabolic pathways
abj01110  Biosynthesis of secondary metabolites
abj01130  Biosynthesis of antibiotics
abj01210  2-Oxocarboxylic acid metabolism
abj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJAB07104_02252
   00290 Valine, leucine and isoleucine biosynthesis
    BJAB07104_02252
   00220 Arginine biosynthesis
    BJAB07104_02252
Enzymes [BR:abj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BJAB07104_02252
    2.6.1.66  valine---pyruvate transaminase
     BJAB07104_02252
Amino acid related enzymes [BR:abj01007]
 Aminotransferase (transaminase)
  Class I
   BJAB07104_02252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase CBM_20
Motif
Other DBs
NCBI-ProteinID: AGQ14620
Position
2322207..2323637
Genome map
AA seq 476 aa AA seqDB search
MSQKKSVLFQQLLPVIKQYQQSGFTHEKIVELLKDQHDLNLVTVKTFKSYLYRYAKVNPA
MSKNTATLQSMPTSREIKKSSKLEHVCYDIRGPVLRAANEMEEQGHKIIKLNIGNPAPFG
FEAPQEIINDVALNLPNAIGYVDSKGIFPARKAICQYYQQKGILNMHVNDVYIGNGVSEL
IVMAMQGLLDDGDEMLIPMPDYPLWTAAVNLSGGTAIHYKCDEENSWYPDIADIESKITS
NTRGIVIINPNNPTGSVYPRHVLEQIVALAKKHDLILFADEIYDKIVYDGIEHVAVASLA
GDQLCISFNGLSKAYRIAGFRSGWMAITGDKSRAADYIEGLDMLASMRLCANVQAQYAIQ
TALGGYQSINDLIRPGGRLYEQRNIAWEMLNEIPGVSCVKPEGAMYCFPRLDPNIYPIED
DEKLMLDLLRAEKVLLVQGTGFNWPTPDHFRVVFLPAENELREAIGRLGRFLANRR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagaaaaaaagtgtgcttttccagcaactattaccagttatcaaacagtatcag
caatcgggctttacccatgaaaaaattgttgaattacttaaagatcaacatgatctgaat
ttggtaacagtcaaaacatttaaaagttatttataccgatatgcaaaagtgaatccagct
atgtctaaaaatactgctactctccaatccatgccaacttcccgagaaattaaaaaatca
tcgaagcttgagcatgtttgttatgacattcgcggaccagtattacgagccgccaatgaa
atggaagagcaaggacataaaatcattaagctgaatatcggcaaccctgccccatttggt
tttgaagcaccacaagaaattattaatgacgttgctttaaacctaccaaatgcaattggt
tatgtagattcaaaaggtatctttccggcacgtaaagcaatctgccagtactaccagcaa
aaaggcatcttaaatatgcacgttaatgacgtgtatatcggtaatggtgtatctgaactc
attgtcatggctatgcaaggcctactcgatgatggtgatgaaatgctcattccgatgccg
gactatccgctatggacagctgccgttaacctgtcgggcggtacagccattcattataag
tgtgatgaagaaaacagttggtatcctgatattgccgatattgaaagtaaaattacttca
aacacacgtggtattgtcattatcaatccgaacaacccaactggttcggtatatccacgt
catgtgcttgagcaaattgtggcacttgcaaagaaacatgacctgattttatttgctgac
gaaatttacgacaaaatcgtttacgatggcattgaacatgttgctgttgcttctttagca
ggcgaccaattatgtatttctttcaatggactatcaaaagcatatcgtattgctggtttc
cgttcaggctggatggcaatcacaggcgataaaagccgtgcagcagactatatcgaaggt
ctggatatgttagcttcaatgcgtttatgtgcaaacgtacaagctcagtatgcaattcaa
acggcgcttggtggctatcagtctattaatgatttgatccgaccaggtggacgtttatat
gaacagcgtaatatcgcatgggaaatgttaaatgaaattcctggtgtaagctgtgttaaa
ccagaaggcgcaatgtattgtttcccgcgtcttgaccctaacatttacccaatcgaagat
gatgaaaagttaatgttagatttacttcgtgctgaaaaagtactattagttcaaggaaca
ggttttaactggccaacaccagaccatttccgtgttgttttcttaccggcagaaaacgaa
ttacgtgaagcaattggtcgtttaggccgtttcttggccaatcgccgttaa

DBGET integrated database retrieval system