KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02369Help
Entry
BJAB07104_02369   CDS       T02726                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abj  Acinetobacter baumannii BJAB07104
Pathway
abj00071  Fatty acid degradation
abj00280  Valine, leucine and isoleucine degradation
abj00310  Lysine degradation
abj00362  Benzoate degradation
abj00380  Tryptophan metabolism
abj00620  Pyruvate metabolism
abj00630  Glyoxylate and dicarboxylate metabolism
abj00640  Propanoate metabolism
abj00650  Butanoate metabolism
abj00900  Terpenoid backbone biosynthesis
abj01100  Metabolic pathways
abj01110  Biosynthesis of secondary metabolites
abj01120  Microbial metabolism in diverse environments
abj01130  Biosynthesis of antibiotics
abj01200  Carbon metabolism
abj01212  Fatty acid metabolism
abj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJAB07104_02369
   00630 Glyoxylate and dicarboxylate metabolism
    BJAB07104_02369
   00640 Propanoate metabolism
    BJAB07104_02369
   00650 Butanoate metabolism
    BJAB07104_02369
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJAB07104_02369
   00072 Synthesis and degradation of ketone bodies
    BJAB07104_02369
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJAB07104_02369
   00310 Lysine degradation
    BJAB07104_02369
   00380 Tryptophan metabolism
    BJAB07104_02369
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJAB07104_02369
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJAB07104_02369
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJAB07104_02369
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abj04147]
    BJAB07104_02369
Enzymes [BR:abj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJAB07104_02369
Exosome [BR:abj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJAB07104_02369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AGQ14737
Position
2446677..2447882
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFADEITPIEVFQGKKLPPKFVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatttatgatggtttacgtagtccatttggccgtcatgcaggtgaa
cttgcctcaattcgtcctgatgatttggccgcaactgtcattcaaaaactactagaaaaa
actggtgtaccgggcgctgatattgaagatgtgattttaggcgacactaaccaagcgggt
gaagatagccgtaatgtggcacgaaatgcattattacttgcaggtttacctgttactgta
ccgggccagacggtaaaccgcctatgtgctagtggtttaggtgccgtgattgactcagca
cgtgctattacttgtggtgaaggtgaactgtatattgctggtggtgtagaaagtatgtca
cgtgcaccctttgtgatgggtaaagcagaaagcgcttatagccgtgatgcaaaaatttat
gacaccaccattggctctcgctttccaaataaaaaaattattgctcagtacggcggacat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagtcgtgagcaagca
gacttatttgcagcccaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gccgatgaaattactccaattgaggttttccaaggcaaaaaattgccccctaaattcgtt
tcagaagatgaacatcctcgcccaagttcaactgttgaagcactcacaaagttaaaaccg
ctatttgaaggtggcgtggttacagctggtaatgcctcaggtattaatgatggtgcagca
gcacttttgattggttcagaagcagcaggtcaaaaatatggcttaaaaccaatggcaaaa
atcttatcagcggcggctgcaggtattgagccacgcattatgggtgcaggtccgatcgaa
gccattaaaaaagcggttgcacgtgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaagttttatcttgtttaaaaggtttaaatgttgatttt
aatgatccacgtgtgaacccgaacggtggtgcgattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcttatgtattggtgtaggtcaaggtcttgcgatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system