KEGG   Acinetobacter baumannii AbH12O-A2: LX00_05600Help
Entry
LX00_05600        CDS       T03374                                 

Definition
(GenBank) ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00040  Pentose and glucuronate interconversions
abk00053  Ascorbate and aldarate metabolism
abk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LX00_05600
   00053 Ascorbate and aldarate metabolism
    LX00_05600
Enzymes [BR:abk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     LX00_05600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIS05852
UniProt: A0A0E1FG16
Position
1185784..1187370
Genome map
AA seq 528 aa AA seqDB search
MSKNNGRQFINGQRVAVNAPALESIAAKDYQPTGYVFSQATLEEVDQTAQAAHNAFLVYS
QTTQEQRASFLEEIARQIEALGANLQEVASLETGLPLARLQGETGRVTGQLRLFAELLRR
GDFYGARIDVALPERKPLPRVDLRQYKVGVGPVAVFGASNFPLAFSTAGGDTVAALAAGC
PVVFKAHSGHMATAELVAEAIEKAIEVCGMPKGTFNMIFGGRIGANLVEHPLIQAAGFTG
SLEGGMALYNLAQSRPQPIPFFAEMSSVNPVVVLPEALYSRGEQIAQDTVASFNMGCGQF
CTKPGLILGIKGPEFDRFITALAENTQKAVPQVMLNEGTLKSYRTGIDALINEAGFEIIA
SGQEPELVSQAKAHLFKADQSVLLSGNPKLQHEVFGPMSIVIGVEDEATLLKGIEALGGQ
LTATIIGDENELSKAGELLDLLTRKAGRVLFNGFPTGVEVSDAMVHGGPFPATSDARGTS
VGTGAIERFLRPVCFQNTPQVLLPDALKDSNPLQITRLVNGQLTQAKI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaataacggtcggcagtttattaatggtcaacgcgttgctgtaaatgcgcca
gctctagaaagtatagctgcaaaagactatcaaccaacaggttatgtatttagtcaggca
acacttgaagaagtagatcagactgctcaagctgcacataacgcttttttagtttatagc
caaacgactcaagaacaacgtgcctcttttcttgaagaaattgctcgccaaattgaagca
ttaggtgccaacctgcaagaggtcgcttcacttgaaacaggtttgccacttgctcgtctt
caaggggagacaggccgtgttactggacagctaagactatttgctgaacttttacgccgc
ggcgatttttatggtgcccgtattgatgtggcattgccagaacgtaagcctttgccgcgt
gttgatttgcgtcaatataaagttggggtaggaccagttgccgtgtttggtgcgagtaat
ttcccactcgcattttcaactgcaggcggtgataccgtagctgctttagcagcaggatgt
ccggttgtctttaaagcacactctggccatatggcgactgctgagcttgttgcagaagcc
attgaaaaagcaattgaagtttgcggtatgcctaaaggcacattcaatatgatttttggt
ggccgtattggtgcaaacttggtagaacatccactgattcaggcagccggttttacaggt
tcacttgaaggaggaatggcgctttataaccttgcgcagagccgtcctcagccgattcca
ttttttgctgaaatgtcgagtgtgaaccctgtggtggttttacctgaagcactttattca
cgtggtgaacaaatcgcacaagatacagttgcttcttttaatatgggatgtggccagttc
tgtacaaaaccgggtctaattttaggtataaaaggccccgagtttgaccgctttattacg
gctttagctgaaaacacgcagaaagctgtgcctcaggttatgttgaatgaaggtacttta
aaaagctatcgaactggtattgatgcattaataaatgaagctggttttgagatcattgca
tcgggtcaggaacctgagctagtttctcaagcaaaagcacatctgtttaaagcggaccaa
tctgttttattgtcaggcaacccaaaactacaacatgaagttttcggaccgatgtcgatt
gtgattggcgtagaggatgaagccactctgttgaagggtattgaagctttaggtggacag
cttacagcaaccattattggtgatgaaaacgaattgtctaaggcaggtgagcttcttgat
ttgttaacccgtaaagctggccgtgtattgtttaatggtttcccgacaggggtagaggta
tcggatgctatggtacatggtggtcctttccctgcaaccagtgatgcccgtggcacttcg
gtaggtacgggagcgattgagcgtttcttgcgtccggtatgtttccaaaatacaccacaa
gttttattacccgatgcattaaaagatagtaatccactacagattactcgtctggttaat
gggcaattaactcaggccaaaatttaa

DBGET integrated database retrieval system