KEGG   Acinetobacter baumannii AbH12O-A2: LX00_05675Help
Entry
LX00_05675        CDS       T03374                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00230  Purine metabolism
abk00250  Alanine, aspartate and glutamate metabolism
abk01100  Metabolic pathways
Module
abk_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:abk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LX00_05675
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LX00_05675
Enzymes [BR:abk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     LX00_05675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AIS05865
UniProt: A0A0Q1T6Y1
Position
1202018..1203337
Genome map
AA seq 439 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKIVDLLTDQAAAVVRYQGGHNAGHTLVVGGKKTVLHLIPSGI
LRENVLCLIGNGVVLSPAALIEEMGILEAEGVPVKERLRISPNCPLILPNHIALDQAREK
KRGNAKIGTTGRGIGPAYEDKVARRAVRVADLVRGGAALEEKLAEMLELHNFQLTQFYGV
EAVKFEDVLALCNQWREVLAPLVIDVTKVLHDYRKEGKAVMFEGAQGSLLDIDHGTYPYV
TSSNTTAGGVSSGSGMGPLHLDYVLGITKAYTTRVGAGPFPTELVYDAASDSGDPIGKHL
GTVGHEFGASTGRQRRCGWFDAEILRRSVDVNSLSGICLTKLDVLDGLEEVKICVGYENT
DSGCVGSSDAVSFECLKPIYETMPGWSESTVGLTSIDQLPANALAYVKRIEQLIECPIDI
VSTGPDRAETIILRHPFSA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaatgttgtggtacttggtacccaatggggcgacgaaggtaaaggtaaaatc
gtcgacctgctcacagatcaggcggctgcggtagtacgttatcaaggcggacataacgca
ggtcatactcttgtcgtaggtggtaaaaagactgtattacacctcattccatcaggcatt
ttacgtgaaaacgtattgtgcttaattggcaatggcgtggtgctttcaccagcagcatta
attgaagaaatgggaattttggaagctgagggtgttccggttaaggagcgtctacgcatt
tctccaaactgtccacttattttgcctaaccacattgctcttgatcaggcacgtgagaag
aaacgtggtaacgctaaaatcggtactacaggtcgtggtatcggtcctgcgtacgaagat
aaagttgcgcgccgtgcagtgcgtgttgctgaccttgttcgtggtggtgcagcgttagaa
gaaaaactagccgaaatgctagagttacataacttccaattgactcagttctacggtgta
gaagcggttaaatttgaagacgtattggctctttgcaaccaatggcgtgaagttcttgct
ccattagtgattgacgtaactaaagtattacatgactaccgcaaagaaggtaaggctgta
atgtttgaaggcgctcaaggttcacttctagacatcgaccacggtacttatccgtatgtt
accagctcaaatacaactgctggtggtgtaagttctggttcaggtatggggcctttacat
cttgattatgtattaggtattacgaaagcttatacaacacgtgtaggtgctggtccgttc
ccaactgaattagtttacgatgctgcgagtgattctggtgacccaattggtaaacatttg
ggtactgtgggtcatgaatttggtgcttctactggtcgtcaacgtcgttgtggttggttt
gatgctgaaatcttacgccgttctgtagatgtaaactcactttcaggtatttgcttaact
aaacttgacgttttagatggtttagaagaagtgaaaatctgtgtgggttatgaaaataca
gattcaggttgtgtaggttcttctgatgcggtttctttcgaatgcttgaaaccaatttat
gaaactatgccaggttggagcgagtcaactgttggtttaacgagcattgaccaattacct
gcaaatgctttggcttatgtaaaacgtattgaacaattaatcgaatgtccgattgatatc
gtttcaactggtccagaccgtgcagaaacaatcattttacgtcatccattctctgcgtaa

DBGET integrated database retrieval system