KEGG   Acinetobacter baumannii AbH12O-A2: LX00_06470
Entry
LX00_06470        CDS       T03374                                 
Name
(GenBank) type VI secretion protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
abk  Acinetobacter baumannii AbH12O-A2
Brite
KEGG Orthology (KO) [BR:abk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abk02044]
    LX00_06470
Secretion system [BR:abk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   LX00_06470
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AIS06017
Position
1369521..1370885
AA seq 454 aa
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHIL
ALESVEMIWQDGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPVLQANKQNLIDQNQS
QKGRYQSHLVETHDLFTNATEADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQ
SSGAFEIDRKFIPPILHVDASETLVSNLKRTLNVIKAKIKTIQTNNRENEQKLIEFRSGD
IVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAGSLLTFSTAYEVDQLPAYKHH
NLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRDTRLYIAVSSS
AMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtttaaagctgaaaaagtcctgtggggcgaaggtttatttttaagacctcaacatttc
cagattcaagatacctatcatgaacaacgtttaaatcacacggttcgtgctgttgtgcca
ttttcctatggcgttcaaaaacttagttttgatgaagcacagttaagtacgcatattctt
gcacttgaatcggtagaaatgatttggcaagacggtgaaatatatcaagcgcctgcttat
gatttattacctgaacctattttgcttgatgagcttaatttacgtggtgagatggtcatc
tatttggcattaccagtattacaagccaataaacaaaatttaatcgatcaaaatcaatca
caaaaggggcgctatcaatcacatttggttgagacccatgatctgttcacaaacgcgaca
gaggctgatatcagcttattacgtcgtcgagctgtgtttaaattattagatgcacatagt
aatcctgatcataatttagatggtttcctatatttgccaataggcaaaattaaacgtcag
agttcaggtgcttttgaaattgaccgcaaatttattccgcccattttgcatgtcgatgca
tctgagaccttggtttcaaatttaaaaagaaccttgaatgttattaaggcaaaaattaaa
acgattcaaaccaataaccgagaaaatgagcagaaattaattgaattccgttcaggtgat
atcgtttcgttttggttggtaaatgctttaaatactgctcatgctggtctgagccatttc
ttgcaatatccgcaaattcatccggaacgcttattctttgaattgctacgtttggcaggt
tcattattaactttctcgacagcttatgaagttgatcagttgcctgcatataaacatcat
aatttgcaagagagcttcacccagctcgacacaattttacgtgatttactcgatacgatt
atttcgagtcgttacatcagtattgcccttaaagaaattcgcccttcatattgggtggga
agtctcgaaaccgataagattactcgagataccagactttatattgctgtatcaagtagc
gcgatgcagacccacgagttgattcaaatcgttcctctacgttttaaaatcggtagtact
ttagatgttgaacaacgtgttgttgcagcattaccagcaattccattacatcacttaatc
caagttccaactgctattccagtacgttcgggtgtgagctattttgaaatcgaaccgcat
catgaactctatcaacgtatgttggattcagaaacgatttgtatttatgttccggctgga
ttccaagatatcagtattgagctgattgcggtcatgaacgcttaa

DBGET integrated database retrieval system