KEGG   Acinetobacter baumannii AbH12O-A2: LX00_12425Help
Entry
LX00_12425        CDS       T03374                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:abk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LX00_12425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abk02000]
    LX00_12425
Enzymes [BR:abk01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     LX00_12425
Transporters [BR:abk02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    LX00_12425
   Histidine transporter
    LX00_12425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 AAA_29 AAA_15 AAA_23 AAA_16 Mg_chelatase Zeta_toxin RsgA_GTPase AAA_18 AAA_28 AAA_22 G-alpha SUKH-4 APS_kinase PRK NB-ARC NACHT AAA_33
Motif
Other DBs
NCBI-ProteinID: AIS07160
UniProt: A0A0E1FH95
Position
complement(2592863..2593639)
Genome map
AA seq 258 aa AA seqDB search
MEQVAKLVIRDLHKTFGDHEVLKGISLDANAGDVISIIGSSGSGKSTLLRCINFLEQPSN
GTIKLNGEKLRTVFDKKGNLKVVEPKQLQKMRTQLMMVFQHFNLWSHMTVLENVIEGPIH
VLGVKRSEAEERARKYLRKVGLPESVESKYPAFLSGGQQQRVAIARALAMEPEVMLFDEP
TSALDPELVGEVLKVMQGLAEEGRTMIVVTHEMGFARHVSNQVIFLHQGKIEEQGHPDEV
FNNPKSERLKQFLTGSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggttgcaaaactagtgattcgcgatttacataaaacattcggcgatcatgag
gtacttaaagggatatcacttgatgcaaatgccggtgatgtaattagtattattggttca
tctggttcaggtaaaagtaccttgctgcgttgtatcaactttttagaacaaccgagcaat
ggcacgattaagctcaatggtgaaaaattacgcacggtctttgataaaaaaggcaattta
aaagtggttgaaccaaagcaactacaaaaaatgcgtacccagctgatgatggtatttcag
cactttaatttatggtctcacatgacagtactggaaaatgtcattgaagggccaatccat
gtacttggagtaaagcgttctgaagcggaagaacgtgcgcgcaaatatctacgtaaagtg
ggattacctgaaagtgttgaaagtaaatatccggcatttttatctggtggtcagcaacaa
cgtgtagcgattgctcgtgctttggctatggaaccggaagtgatgttgtttgatgaacca
accagtgcgcttgacccagagttggtaggtgaagtactaaaagtaatgcagggcttggct
gaagaaggacgtaccatgattgtggtgacacatgaaatgggtttcgcgcgtcatgtatct
aatcaggtgatttttttgcatcaagggaaaattgaggaacagggccatcctgatgaagta
ttcaataacccgaaaagtgaacgtttaaagcaatttttgacgggcagtttaaaataa

DBGET integrated database retrieval system