KEGG   Acinetobacter baumannii AbH12O-A2: LX00_15580Help
Entry
LX00_15580        CDS       T03374                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00071  Fatty acid degradation
abk00072  Synthesis and degradation of ketone bodies
abk00280  Valine, leucine and isoleucine degradation
abk00310  Lysine degradation
abk00362  Benzoate degradation
abk00380  Tryptophan metabolism
abk00620  Pyruvate metabolism
abk00630  Glyoxylate and dicarboxylate metabolism
abk00640  Propanoate metabolism
abk00650  Butanoate metabolism
abk00900  Terpenoid backbone biosynthesis
abk01100  Metabolic pathways
abk01110  Biosynthesis of secondary metabolites
abk01120  Microbial metabolism in diverse environments
abk01130  Biosynthesis of antibiotics
abk01200  Carbon metabolism
abk01212  Fatty acid metabolism
abk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LX00_15580
   00630 Glyoxylate and dicarboxylate metabolism
    LX00_15580
   00640 Propanoate metabolism
    LX00_15580
   00650 Butanoate metabolism
    LX00_15580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LX00_15580
   00072 Synthesis and degradation of ketone bodies
    LX00_15580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LX00_15580
   00310 Lysine degradation
    LX00_15580
   00380 Tryptophan metabolism
    LX00_15580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LX00_15580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LX00_15580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LX00_15580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abk04147]
    LX00_15580
Enzymes [BR:abk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LX00_15580
Exosome [BR:abk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LX00_15580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: AIS07748
UniProt: A0A0B9WQP0
Position
3246289..3247494
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTSKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHSGVVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAVALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKILATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacatctaaagtagatgatattgttctgggctgcgtaacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccatgggccttagatccggaaaccaac
cttaaatcatcttttgttccacaaggtgtcggcgctgacctcattgcaaccttagatggt
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgcctgtcaaagatcactcaggtgttgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaagggttagcaaagctc
aacccaagttttgaaatgatggggcaaatgggctttgatgctgttgccctgcaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgccggtaactcatcaggtattgtcgat
ggagcagctcttgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaaattttggcgactgcattagtcggtactgatccaaccattatgctgactggc
cctgcgcctgctgcacgcaaagccttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtaatgcgttttataaatgaactcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggtcatcccttaggg
gcaactggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgccaccattattgaacgt
gtataa

DBGET integrated database retrieval system