KEGG   Acinetobacter baumannii AbH12O-A2: LX00_18035Help
Entry
LX00_18035        CDS       T03374                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
abk  Acinetobacter baumannii AbH12O-A2
Pathway
abk00270  Cysteine and methionine metabolism
abk00480  Glutathione metabolism
abk01100  Metabolic pathways
Module
abk_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:abk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LX00_18035
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LX00_18035
Enzymes [BR:abk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     LX00_18035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AIS08201
UniProt: V5V8R8
Position
complement(3736426..3737370)
Genome map
AA seq 314 aa AA seqDB search
MRVLVVMDPIETVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAYGLISPLKVFE
DYNHYYELGEKKKESIAAYDVVLMRKDPPFDMNFVYTTYVLEQAEREGSWIINKPQSLRD
CNEKLFATQFPELQVPTLVTSQQSLIREFITEHGDVIVKPLDGMGGMGIFRLYQDGVNIG
STLEMLTELGTRPIMAQRYIPEIVEGDKRILMVNGEPIPYCLARIPQNGEVRGNLAAGGL
GQARPLTENDKLIAAKVGPFLREKGLVFVGLDVIGNYVTEINVTSPTCIREIDAQFGTSI
ADDLFDVLEAGRPA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtacttgtcgtcatggatccgattgaaaccgtaaatctgaaaaaggattcaacc
atggcaatgttgtgggcggcgagccgtcgtggacatgagttaggttatgcattacaacaa
gatttatatatcgatcaaggtaaggcttacggtctcatctctccgttaaaagttttcgaa
gattacaaccattattatgagttaggcgaaaagaaaaaagaatcaatcgcggcttatgat
gttgtcctcatgcgtaaagatccgccttttgacatgaactttgtctacacaacttacgtg
cttgaacaagctgagcgtgaaggttcatggattattaataagccccaatcactgcgtgac
tgcaatgaaaaattgtttgctacgcaatttcctgaattacaggtgccaacacttgtaaca
tcgcagcagagtttgattcgcgaatttattactgagcacggtgatgtgatcgttaagcca
cttgatggtatgggtggtatgggtattttccgtttataccaagacggtgtaaatattggt
tctaccttagaaatgcttacggaattaggcacccgcccaattatggctcagcgttatatt
cctgaaattgtagaaggggataaacgaattttaatggtaaatggcgagcctattccttac
tgtctggcacgtattccgcaaaatggtgaagtacgcggtaacttggcagctggtggctta
ggtcaagcgcgtccactcacagaaaatgacaaactcattgctgctaaagttggtcctttc
ttacgtgaaaaaggtttggtatttgtaggtcttgatgtaattggaaattatgtcactgaa
attaatgtgacaagcccaacctgtattcgtgaaattgatgcgcaatttggtacatcaatt
gccgatgacctatttgatgtattagaagccggtcgtccagcataa

DBGET integrated database retrieval system