KEGG   Arcobacter butzleri 7h1h: A7H1H_0044Help
Entry
A7H1H_0044        CDS       T02755                                 

Definition
(GenBank) inorganic phosphate transporter, PitA family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abl  Arcobacter butzleri 7h1h
Brite
KEGG Orthology (KO) [BR:abl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A7H1H_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HEPN_AbiV wnt
Motif
Other DBs
NCBI-ProteinID: AGR76381
UniProt: S5P7G1
Position
56336..57931
Genome map
AA seq 531 aa AA seqDB search
MDIKTLNTLDKATQGTMPSFAKFSLSLLFILMVFLWTYTSHGTIPDNAFLIVGAVFGAYM
AINIGANDVANNVGPAVGARALTLTGAVIVAAIFEAAGAIIAGGDVVNTIKSGIIDPSLI
TDPHVFIWAMTAGLLAGAVWLNFATSIGAPVSTTHAIVGGVMGAGIAGVGFSIVNWSSVG
SIVASWIISPLFGGIIAAGFLFFIKTKIIFCEDKIAAANKFVPILIAVMTWAFSTYLMLK
GLRQVVHISFISASILSLIFAVIVYFVLKPIIFAKSLNLKNDRTSVNSLFTIPLIFGAAL
LSFAHGANDVSNAIGPLAAINDAVLTLAEGSFPHASVGVPFWIMAVGASGIVIGLILYGP
RLIRTVGSEITELDQVRAFSIAMATAITVIVASQLGLPVSSTHIAIGGVFGVGFLREIMD
SSEKKYIQDAREKFRKHKKKLENMQIELKKFELIKDKSKSDYIKIVDLFKKIDEVEAIVE
QERKDFKEAKGVKYVKRDAVKKIIAAWVITVPASALLAAGIFYMIKGIVIV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaaactctcaacaccttagataaggcaacccaaggcacaatgccaagtttt
gcaaagttcagtttatctttgctttttattttaatggtatttttatggacatatacttct
catggtacaattccagataatgcatttttaattgttggtgctgtttttggtgcttatatg
gcgattaatattggggcaaatgacgttgcaaacaatgtaggacctgctgttggtgcaaga
gctttaactcttacaggagctgttattgttgcagcaatttttgaagctgctggagctata
attgctggtggtgatgttgttaatacaattaaaagtggaattatagacccatctttaatc
actgatcctcatgtatttatttgggcaatgacagcaggtcttttagcaggtgctgtttgg
cttaattttgctacttcaattggagctcctgtttcaacaactcatgctattgttggtggt
gtaatgggtgctggtattgctggagttggtttttctatagtaaattggagcagtgttgga
agtattgttgcttcttggattatttcacctttatttggtggaattattgctgcaggattt
ttgttttttattaaaacgaagattattttttgtgaagataaaattgctgctgcaaacaaa
tttgttccaattttaattgcagttatgacatgggcattttcaacttatttgatgttaaaa
ggtttaagacaagttgttcatattagttttatttctgcttctatccttagtttaattttt
gctgtaatcgtatattttgttctaaaacctataatttttgcaaaatcactaaatttgaaa
aacgatagaacaagtgtaaatagtttatttactatacctttgatttttggtgcagcactt
ttatcatttgctcatggtgcaaatgatgtttcaaatgctattggacctcttgctgctatt
aatgatgcagttttaactttagcagaaggttcttttcctcatgcaagtgtaggtgttcca
ttttggattatggctgttggtgcaagcggtattgtaataggacttattttatatggacca
aggcttatacgaacagttggttctgaaattactgaacttgatcaagtaagagctttttct
atagcaatggctacagcaattacagttatcgttgcaagtcaattaggtttaccagtttct
tctacacatatcgcaattggtggagtttttggagttggttttttaagagaaataatggat
tcaagtgagaaaaaatatatccaagatgcgagagagaaatttagaaaacataagaaaaaa
cttgagaatatgcaaattgaattaaaaaaatttgagttgattaaagacaaatcaaaatca
gattatattaaaattgttgatctatttaaaaaaatagatgaagttgaagccatagttgaa
caagagagaaaagattttaaagaagcaaaaggtgttaaatacgtaaaaagagatgcagtt
aaaaagataattgctgcttgggttatcaccgttcctgcttctgctcttttggctgctggt
atcttttatatgattaaaggtatcgttattgtgtaa

DBGET integrated database retrieval system