KEGG   Arcobacter butzleri 7h1h: A7H1H_1030Help
Entry
A7H1H_1030        CDS       T02755                                 

Gene name
gatA
Definition
(GenBank) Glu-tRNA(Gln) amidotransferase, subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
abl  Arcobacter butzleri 7h1h
Pathway
abl00970  Aminoacyl-tRNA biosynthesis
abl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7H1H_1030 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:abl03029]
    A7H1H_1030 (gatA)
Enzymes [BR:abl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A7H1H_1030 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A7H1H_1030 (gatA)
Mitochondrial biogenesis [BR:abl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A7H1H_1030 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF5610
Motif
Other DBs
NCBI-ProteinID: AGR77331
UniProt: S5PA81
Position
974705..976063
Genome map
AA seq 452 aa AA seqDB search
MTLKEALSLASDDIKKLRDDLTSKIKESKIGAYVEQLTSTDISQSGVGIPIAIKDNINVK
NWEITCSSNILKDYISPYNATVIEKLEKAGLSPFGRTNMDEFAMGSSTESSCYGKTLNPI
DNEKVPGGSSGGSAAAVAGGIAIAALGTDTGGSIRQPAAYCGCVGMKPTYGRVSRYGITA
YSSSLDQCGPITQNVEDAAILYDIISGYDPMDSTSANINYEAVTPKLNSDKKLTIAVIDN
FVSQASPAIQKGFQKAVNALEEAGHKIIHKNMLDTQKIVSTYYIVATAEASANLARFDGV
RFGNRKGESGLKDMYVQTKSQGFGHEVQKRIMLGSFVLSSGYYDAYYIKAQKVRHLIKDE
YSKIFSEADLILSPVAPTTAPKFGSFKTSLEMYLSDIYTISVNLAGLPAISLPVDKDEDG
MPIGLQFIANAYEEQTLFDGALSLEKAINYKK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaagaagcactaagtttagctagtgatgatataaaaaaattaagagatgat
ttaacttcaaaaataaaagagagcaaaataggtgcttatgttgaacaattaacttcaaca
gatatttcgcaatcaggcgtaggtattccaatagcaataaaagataatataaatgttaaa
aattgggaaataacttgttctagtaatattttaaaagactatatttcaccttataatgca
acagttattgaaaaattagaaaaagcaggtttaagtccatttggtagaacaaatatggat
gaatttgcgatgggaagttcaactgaatcttcttgttatggaaaaactttaaatccaata
gataatgaaaaagttccaggtggaagtagtggaggaagtgctgcagctgttgctggtggt
attgcaatagcagcacttggaacagatactggtggtagtattagacaacctgcagcttat
tgtggttgtgttggaatgaaaccaacttatggaagagtttcaagatatggaattacagct
tattcatcttcacttgatcaatgtggaccaattactcaaaatgttgaagatgctgctatt
ttatatgatattatttctggatatgatccaatggattctacttcagcaaatatcaattat
gaagcagttactccaaaacttaatagcgataaaaaactaacaattgctgttattgataac
tttgtatcacaagcaagtcctgcaatacaaaaaggttttcaaaaagcagttaacgcttta
gaagaagcagggcataaaatcattcataaaaatatgcttgatactcaaaaaattgtttca
acttattatatagttgcaactgcagaagctagtgcaaatttagctagatttgatggtgtt
agatttggaaatagaaaaggtgagagtggattaaaagatatgtatgttcaaacaaaatca
caaggttttggtcacgaagtacaaaaaagaattatgttaggttcatttgttttaagttct
ggatattatgatgcttattatattaaagctcaaaaagtaagacatttaataaaagacgaa
tattctaaaatttttagtgaagctgatttgattttatctccagttgctcctactacagct
ccaaaatttggttcatttaaaacttctttagagatgtatttaagtgatatttatacaatt
tctgtaaaccttgcaggacttccagctatttctttacctgttgataaagatgaagatgga
atgccaattggattacagtttattgcaaatgcatacgaagaacaaactttatttgatggt
gctttatctttagaaaaagctataaattataaaaaataa

DBGET integrated database retrieval system