KEGG   Acinetobacter baumannii SDF: ABSDF0591Help
Entry
ABSDF0591         CDS       T00660                                 

Definition
(GenBank) putative thiolase; acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00071  Fatty acid degradation
abm00280  Valine, leucine and isoleucine degradation
abm00310  Lysine degradation
abm00362  Benzoate degradation
abm00380  Tryptophan metabolism
abm00620  Pyruvate metabolism
abm00630  Glyoxylate and dicarboxylate metabolism
abm00640  Propanoate metabolism
abm00650  Butanoate metabolism
abm00900  Terpenoid backbone biosynthesis
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
abm01212  Fatty acid metabolism
abm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABSDF0591
   00630 Glyoxylate and dicarboxylate metabolism
    ABSDF0591
   00640 Propanoate metabolism
    ABSDF0591
   00650 Butanoate metabolism
    ABSDF0591
  Lipid metabolism
   00071 Fatty acid degradation
    ABSDF0591
   00072 Synthesis and degradation of ketone bodies
    ABSDF0591
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABSDF0591
   00310 Lysine degradation
    ABSDF0591
   00380 Tryptophan metabolism
    ABSDF0591
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABSDF0591
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABSDF0591
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABSDF0591
Enzymes [BR:abm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABSDF0591
Exosome [BR:abm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABSDF0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: CAO99970
UniProt: B0VRH6
Position
complement(543233..544438)
Genome map
AA seq 401 aa AA seqDB search
MSEAYIIDAIRTPRGKGKKDGSLYEVKPITLLTTLLNELQQRHQLDTSKVDDIVLGCVTP
IGDQGGDIAKTAAIAAGWNDDVAGVQINRFCASGLEAVNMAAMKVRSGWEDLVVAGGVES
MSRIPMGSDGGPWALDPETNLKSSFVPQGVGADLIATLDGYSREDVDNFAVKSQQKAAAA
QANGYFDQSVVPVKDHAGVVILEKDEFIKGNTTLEGLAKLNPSFEMMGQMGFDAIALQKY
PEAQKVNHVHHAGNSSGIVDGAALVLLASEKAVKEQNLKPRAKVLATALVGTDPTIMLTG
PAPAARKALEKAGLTIDDIDLFEVNEAFAAVVMRFINELNVPAEKVNVNGGAIALGHPLG
ATGAMILGTLLDELERQNKKRGLATLCVGGGMGIATIIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcttatattattgacgccattcgcacaccacgcggaaaaggaaaaaaagac
ggctctctttacgaagtaaaaccaatcacattactcaccactctattaaacgaattacag
caacgccatcaactcgatacatctaaagtagatgatattgttctgggctgcgtgacacca
attggtgatcagggcggtgatattgccaaaacagcagcgattgcagcgggctggaatgat
gatgttgcaggtgtgcaaattaaccgcttttgtgcttcaggtttagaagcggtcaacatg
gcagccatgaaagttcgttctggttgggaagatttagtggttgctggtggcgttgaatca
atgtcacgtatcccaatgggttctgatggcggaccgtgggcgttagatccggaaaccaac
cttaaatcatcttttgttccgcaaggtgttggcgctgacctcattgcaaccttagatggc
tatagccgagaagatgttgataattttgccgtaaagtcacaacaaaaagcagcggcagct
caagcaaatggttatttcgatcaatcagttgtgccagttaaagatcacgcaggtgttgtg
attttagaaaaagatgaatttattaaaggcaataccacacttgaaggtcttgcaaaactc
aacccaagttttgaaatgatggggcaaatgggctttgatgctattgccctacaaaaatat
ccagaagcacaaaaagtaaatcatgttcatcatgccggtaactcatcaggtattgtcgat
ggagcagctctcgttttactggcttcagaaaaagcagtgaaagaacaaaacttaaaacca
cgcgctaaagttttggcgactgccctagtcggtaccgacccaaccatcatgttaactggc
cctgcccctgccgcacgcaaagctttggaaaaagctggtttaacaattgatgatattgac
ctatttgaagtcaacgaagcatttgcagctgtcgtgatgcgttttattaatgagctcaat
gtgcctgctgaaaaagtcaacgtaaatggcggtgcgattgctttaggccatcccttagga
gcaaccggtgccatgattttgggtacattacttgatgagcttgaacgtcaaaataaaaaa
cgcggtttagcaacgctctgtgtcggcggtggtatgggtattgctaccattattgaacgt
gtataa

DBGET integrated database retrieval system