KEGG   Acinetobacter baumannii SDF: ABSDF0602Help
Entry
ABSDF0602         CDS       T00660                                 

Definition
(GenBank) putative acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00071  Fatty acid degradation
abm00280  Valine, leucine and isoleucine degradation
abm00310  Lysine degradation
abm00362  Benzoate degradation
abm00380  Tryptophan metabolism
abm00620  Pyruvate metabolism
abm00630  Glyoxylate and dicarboxylate metabolism
abm00640  Propanoate metabolism
abm00650  Butanoate metabolism
abm00900  Terpenoid backbone biosynthesis
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
abm01212  Fatty acid metabolism
abm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABSDF0602
   00630 Glyoxylate and dicarboxylate metabolism
    ABSDF0602
   00640 Propanoate metabolism
    ABSDF0602
   00650 Butanoate metabolism
    ABSDF0602
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABSDF0602
   00072 Synthesis and degradation of ketone bodies
    ABSDF0602
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABSDF0602
   00310 Lysine degradation
    ABSDF0602
   00380 Tryptophan metabolism
    ABSDF0602
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABSDF0602
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABSDF0602
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABSDF0602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abm04147]
    ABSDF0602
Enzymes [BR:abm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABSDF0602
Exosome [BR:abm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABSDF0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Tex_N
Motif
Other DBs
NCBI-ProteinID: CAO99981
UniProt: B0VRI7
Position
complement(556093..557271)
Genome map
AA seq 392 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLSGLTAPELGAVTIKEAIARAGLQPTDVEEVIMGCVLPAG
LKQGPARQAMRKAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSAEIVVAGGMESMTN
APYVLPKARAGYRMGHGEIKDHMFFDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKCAQTAITEGYFKDEIVPVTVSTRKGDVIVDQDEQPLNAKIDKIPSLKPAFAKDGTI
TAANASSISDGASALVLTSSEVAAQRGLQPLAKIIATASNSQHPSEFTIAPVGAIEKVLK
KAGWNAQDVDLWEINEAFAMVTMCPIDDFKLDPEKVNIHGGACALGHPVGSTGSRIILTL
IHALKRTGGKKGVAALCIGGGEATAVAIEILY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtaattgttaatggtgctcgtactgctatgggtggttttcaaggatca
ctatcaggactaactgctcctgaattaggagcggtaacaattaaagaagcaatcgcacga
gcaggtttacagcctacagatgtcgaagaagtcattatgggttgcgtactaccagcgggt
ttaaagcaaggccctgctcgtcaagccatgcgtaaagcaggtttacctgattcaacagga
gctgtgacaattaataagctttgtggttcaggtatgaaggcggtaatgcaagcggctgat
atgattaaagcaggaagtgctgaaattgtagttgccggtggtatggagtcgatgaccaat
gcgccttatgtcttacccaaagcacgtgcgggataccgtatgggccacggtgaaattaaa
gaccatatgttctttgatggcttagaagatgctgaaactggacgtttaatgggttcattt
gctcaagatatggcaaatacacgtggttatactcgtgagcaaatggatgactttgcaatt
cgctctttaaaatgtgctcaaactgcgattactgaaggctatttcaaagatgaaattgta
cctgttactgtttctacccgtaaaggtgatgtcattgtcgatcaggatgaacaaccctta
aatgccaagattgataaaatcccatcacttaaaccagcttttgcaaaagacggtacaatt
actgctgcaaacgcgagttcaatttctgatggtgcttctgcactggttttaacatcgagt
gaagttgcagcacagcgtggcttacaaccacttgcaaaaatcatagccactgcgtcaaat
tctcaacatccttcagaatttacaattgctcctgttggcgctattgaaaaagtacttaaa
aaagcaggttggaatgctcaggacgttgacctttgggaaattaatgaagcttttgctatg
gtaacgatgtgtccaattgatgatttcaaacttgatccagaaaaagtcaatattcatggt
ggagcatgtgcacttggtcaccctgtaggatcgacaggttctcgtattattcttacgctt
attcatgcgcttaaacgtactggtggtaaaaagggtgtcgctgctctttgcatcggcggt
ggagaagcaacagctgttgccatcgaaattctttactaa

DBGET integrated database retrieval system