KEGG   Acinetobacter baumannii SDF: ABSDF2214Help
Entry
ABSDF2214         CDS       T00660                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm00071  Fatty acid degradation
abm00280  Valine, leucine and isoleucine degradation
abm00310  Lysine degradation
abm00362  Benzoate degradation
abm00380  Tryptophan metabolism
abm00620  Pyruvate metabolism
abm00630  Glyoxylate and dicarboxylate metabolism
abm00640  Propanoate metabolism
abm00650  Butanoate metabolism
abm00900  Terpenoid backbone biosynthesis
abm01100  Metabolic pathways
abm01110  Biosynthesis of secondary metabolites
abm01120  Microbial metabolism in diverse environments
abm01130  Biosynthesis of antibiotics
abm01200  Carbon metabolism
abm01212  Fatty acid metabolism
abm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABSDF2214
   00630 Glyoxylate and dicarboxylate metabolism
    ABSDF2214
   00640 Propanoate metabolism
    ABSDF2214
   00650 Butanoate metabolism
    ABSDF2214
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABSDF2214
   00072 Synthesis and degradation of ketone bodies
    ABSDF2214
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABSDF2214
   00310 Lysine degradation
    ABSDF2214
   00380 Tryptophan metabolism
    ABSDF2214
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABSDF2214
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABSDF2214
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABSDF2214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abm04147]
    ABSDF2214
Enzymes [BR:abm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABSDF2214
Exosome [BR:abm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABSDF2214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAP01538
UniProt: B0VRM0
Position
2040131..2041420
Genome map
AA seq 429 aa AA seqDB search
MSQNTVRRVAILGGNRIPFARSNTAYFKASNSDMLTAALNGLVERFNLQGKRIGEVVAGA
VLKHSRDFNMTREVVLSTDLAPETPAYDIQIACGTGLQAAFVVANKIALGQIDVGIAGGV
DTTSDAPIAVGDGLRKVLLELNVAKTGKDRLKALTKIDFKKLLDAPSNGEPRTGLSMGEH
QAITALEWGITREAQDELAASSHQKLAAAYERGFFDDLMTPFLGLNRDNNLRPDSTVEKL
AKLKPVFGKGETATMTAGNSTPLTDGASVVLLASEEWAKENGHEVLAYLSFSETAAVDFI
GKNGPKEGLLMAPAYAVPRMLKRANLKLQDFDFYEIHEAFASQVLSTLKAWEDEKFCKER
LGLDAPLGSIDRSKLNVNGSSLGAGHPFAATGGRILATAAKLINEKGSGRALISICTAGG
EGVVAIVEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaacactgttcgccgcgttgcaatccttggtggcaaccgtattccatttgca
cgttcaaataccgcctactttaaagcgtctaattctgacatgctgacagcagcattgaat
ggtttggttgagcgctttaacttacaaggtaaacgtattggcgaagttgttgcgggcgct
gttttaaaacatagccgtgacttcaacatgactcgtgaagttgtattgagcacagatctt
gctcctgaaactcctgcttacgacatccaaattgcatgtggtacaggtttacaagcagca
tttgttgttgctaacaaaattgcgcttggtcaaatcgacgtaggtattgcaggtggcgta
gatacaacttctgacgcaccgattgctgtaggtgatggtttacgtaaagttttacttgag
cttaatgttgctaaaacaggtaaagaccgtcttaaagctctaacaaagattgattttaaa
aagcttcttgatgcaccaagcaatggtgaaccacgtactggcctttcaatgggtgagcac
caagcaatcactgcattagaatggggtatcactcgtgaagcacaagacgagctagctgca
agcagccatcaaaaacttgctgctgcttatgagcgtggtttttttgatgacttaatgact
ccattcttaggtcttaaccgtgacaacaacttacgtcctgacagtacagttgaaaaactt
gctaagttaaaaccagttttcggtaaaggcgaaactgcaacaatgacagcgggtaactca
actccgttgactgatggtgcttctgtggtattgcttgcttctgaagaatgggcaaaagaa
aacggacatgaagttttagcttatctttctttctctgaaacagcagctgttgacttcatt
ggcaagaacggtcctaaagaaggcttattgatggctcctgcttatgcagtacctcgtatg
cttaagcgtgctaaccttaagcttcaagacttcgatttctacgaaatccatgaagcattt
gcatctcaagtactctctaccctaaaagcttgggaagatgaaaaattctgtaaagaacgt
cttggcttagatgcaccattgggttcaattgaccgctctaaactgaacgtaaatggttca
tctttaggtgcaggtcacccatttgctgcaactggtggtcgtatcttggctactgcagct
aaattaattaatgaaaaaggttcaggccgcgcattaatctcgatctgtacagcaggcggt
gaaggtgtggttgcgattgtagaaaaataa

DBGET integrated database retrieval system