KEGG   Acinetobacter baumannii SDF: ABSDF2244Help
Entry
ABSDF2244         CDS       T00660                                 

Definition
(GenBank) conserved hypothetical protein; putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
abm  Acinetobacter baumannii SDF
Pathway
abm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ABSDF2244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abm02044]
    ABSDF2244
Secretion system [BR:abm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ABSDF2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C DUF4381 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CAP01567
UniProt: B0VRP9
Position
complement(2069874..2073698)
Genome map
AA seq 1274 aa AA seqDB search
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALAFAYALGLIVYGIYWLIQ
RKKHAVQGEELAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAAL
YELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDT
AGRYSVYSEDHSEWLGFLNILKKNRSKAPVHGLILIVSIAELVSQSPEHSLKLAKNLRAR
IQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDL
FEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKTALKSFIATLFEDNPYQ
FQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNK
VVQLEKSSGQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLK
GVKQIVLIPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNA
LKAYLMMSNPQYLDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDK
QFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVSQIVGDANKNI
VLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQL
TALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQ
GKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAV
GFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSAS
LQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQFVMNFQRY
VAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVN
FIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTD
PSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaattttaggctacttgtggcagtacatcacgaatcctaaagcaattatcgcc
ttgtcattgttcgtggcattgatgtcttcctatacttcaattcctcgccatatattttgg
gctttagcatttgcatatgctttagggctcatcgtttatggaatttattggctaattcag
cgtaaaaagcatgctgtccaaggtgaagaacttgcgcaagcgattgaaaaggatacacaa
gcagagtacggcaaaaataaagataaagaagagctgcaacttattagccaacaaatgaaa
gaatctattcaattgattcgtaagtcaaagctaggcgataaaaaggggaacgcagcacta
tatgagttgccatggtatatggtcattggtaatccggctgctggtaaaagttctgcgatc
tataattctggtttaaagtttccttttgaagaaacccatcaaaaaatggtttcggctggt
ttaagcggtacgcgtaattgtgactggtttttttcgactgagggtattttactcgacact
gctggacgttattcggtctatagtgaagatcactctgaatggttaggctttttaaatatc
ttaaagaagaaccgttctaaggctccagtacatggtttaattcttattgttagtattgct
gagcttgttagccagagtcctgaacactcattaaagcttgcgaaaaatttacgcgctcgt
attcaggatttaaccgaacgtttagaagtggttgtacctgtatatctagtcttttcaaaa
atggatttgatcgcgggttttaccgaatttttcgaattctatgaagcacaagaatataat
caggcgtggggcgcaacactaccatatgagcaaaactcttctcataatgctgtagatctt
tttgagaaacactacaatattctttatgacggtttaaaaggggtcagttcaactcatctt
agccgtcgacattctcaaaatatctcacctagtgtgatgactttcccattagaatttaag
acattaaaaactgcattaaaaagttttattgcgacactgtttgaagataacccttaccag
ttccaaccagttttccgtgggttttatttcacaagtgctttgcaagaaggcgtaatagaa
agtccaatgactgagcaaattgcacaggaattccagctttcccaaattgctcaaagtgaa
gtaaaagatcagctaaaaacaacgcctaaccatggttatttcttaaaaggcttgttttca
gatgtcattttaaaagataaagatctggttaaacagcatgtcaatacaagcaaaaagcgt
cagcgttatattgcatttattggtgctttagctggcgtatccattattctgggtgtgtgg
gtttggtcatatcgtaacaatcaacaacttattgccgaagttcaagctgatttgaataaa
gttgttcaattggaaaagagttcaggtcaacaattgtcgactcaattagaggccttactt
atcttgcaaagacgtctacaacagttagacgaatttgatgaaaatagaccactaaaattt
agttttggtttatatcaaggtaatgagctacgtgaaaaattaaaagctgaatatttaaaa
ggtgttaagcaaattgttttgatacctacacagcaaaatattgctcagtatttgcaacgt
gtaaaaaataacgaagcaactttaaaagcaaatcataccaatgttgagatcaagcaaact
gcccaaactcagcaatatttagagccttcggataccaaccctcaagatgcttataatgct
ttaaaagcatatttaatgatgagcaatccacagtatttggatgcaagtcacttaagtgat
caggtaacgcgtttctggcgttcttggcttgatgccaataaagggcagatgccacgtgca
gatatgatccaagaagctgagcagatcttatcttatgcaatgacattggcaaatgataaa
caattcccgatcttggatgctgactctcaactcgtggatcagacacgtcaagtattgctc
tctgttattagaggtatgccagcacgtgaccgtgtttataatgaaattaaaatgcgtgct
gctgtgcgcttcccagctttaactgtaagccagattgtaggtgacgcaaataaaaatatt
gtattgggtagttatgcattaccaggggtatttactcaaaaagcttggaatgagtatgta
gaaaaagcaattgaggaagcagcagacaaacctacggatactaaagactgggtgcttaat
agccgtcaatctgatgatttaactttctctggtagtccagagcaaatcagaaagcagctt
actgcattgtataaacaagaatatattgcagagtggagaaaattcttaagtggtattcac
tatgcaaaagcaactcagtttgctcagcaagttaaaaatattgatgtattgggtgaacca
caaaattcaccaattcgcacacttattgaacgcgtagctattgaaacaaattgggataat
ccggtcgttcaagccgagttagcagcacctcaaaaaggatttattgcatggtttaaacgt
aaggttttaaatcatgatgataaacaattagcaaatcaggctgtaacgaatgctcaaggg
cctatttctcaagaatatcaaatgttctatcaattggttcgtaaacgtgatgatcagcaa
ggtaaatctttgcttgatgaatatatgacgaatcttgccttagtacgtagtaagtttaat
gaacttaagaatgcgggtgagattggaccgaatgcgatgacattggttaagcaaacttta
aatgagcagacatcggtatttaaccagactcaaaaaattgtagatgaaaagatggcggtt
ggtttcagtgaaattgatcagcaacttctacaaaaattagtggtgagtccacttacccaa
gcctttgaaagtttaattacacctactcaagatgaaattaataagctatgggtaatgcaa
gcctatcaaccatttactgcaaatcttgctaagaaatatccatttaactcatcagcttct
ttacaagcaacaagtagtgaaattggacaaattcttggtgaaaacggcagtatttcccgt
tttgttaaagagagtttagatccgtttgttatccgccgtggttatactttaacttcaaaa
acatggaaagatttggggattagtttaaacccacaatttgttatgaacttccaacgctat
gttgcacctacaaatggaatggcaacaggtgagttaaatagccaagcaccagctgctccg
gcaaccaatcagtctaacttccagttctacccaattcaaaacccgcaattactttcatat
accgttgatattgatggtcagcgtatgacttatgaaaatggggtgcagcaatgggttaac
tttatttggccaaatcaaggcagtattccgggtgctcgtattacagctgtagatttacaa
ggtcaaacacataccatttttgatgaaccaggcgaatacgggattaaccgtttaatcgat
agtgcacagcgtaaagagcaaaacggtggttttgaaatgctttggcgcagtaagacagat
ccatcactctttgtgaaaatgaacttccgtcttattagtagtaattcaggaagtatcggt
tcaagccgtggctactctggtatgcaactggttgacaaagtaactgcggataaggctgct
cgcgttgtatccgcacagcaagcaccagctcaggcagctgctcctgccaaaactgaaaat
ccagtttctgcactagcacaacctgctgcgggagttaagccatga

DBGET integrated database retrieval system