KEGG   Acinetobacter baumannii AB0057: AB57_0029Help
Entry
AB57_0029         CDS       T00793                                 

Definition
(GenBank) thiol:disulfide interchange protein
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abn  Acinetobacter baumannii AB0057
Brite
Enzymes [BR:abn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AB57_0029
Chaperones and folding catalysts [BR:abn03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AB57_0029
Secretion system [BR:abn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AB57_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 Thioredoxin TraF Thioredoxin_5 Thioredoxin_8 Glutaredoxin Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: ACJ39461
Position
29310..30008
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPT
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctgggctatatagtgctaatctggaccagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggctctatgattcggttaaaagaccaaaag
aacttaactaaagatctggttttaggacagaactcaattgattggaaacagttgccttta
aaagatgccattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaagcagcttgaacctgaactcgacaagcttaaagatgtcact
atttacacttttatctatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaacg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgatctgcc
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system