KEGG   Acinetobacter baumannii AB0057: AB57_0636Help
Entry
AB57_0636         CDS       T00793                                 

Definition
(GenBank) aconitate hydratase 1
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00020  Citrate cycle (TCA cycle)
abn00630  Glyoxylate and dicarboxylate metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01200  Carbon metabolism
abn01210  2-Oxocarboxylic acid metabolism
abn01230  Biosynthesis of amino acids
Module
abn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
abn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB57_0636
   00630 Glyoxylate and dicarboxylate metabolism
    AB57_0636
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     AB57_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ACJ40057
Position
679159..681915
Genome map
AA seq 918 aa AA seqDB search
MAKYSNINSFNALQTLTVGSSNYQIFSLTQAEKKLGDIAKLPKSLKVLLENLLRFEDQHS
VKTEHIYALAEWLKTRTSDQEIQYRPARVLMQDFTGVPAVVDLAAMRAAMAEAGGDPEKI
NPLSPVDLVIDHSVMVDHFADDQAFEENVQIEMQRNGERYQFLRWGQSAFNNFSVVPPGT
GICHQVNLEYLAQAVWLGEDNGQTFAFPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAM
LGQPISMLIPEVIGFKLTGKLQEGITATDLVLTITQMLRQKGVVGKFVEFYGDGLADLPL
ADRATIANMAPEYGATCGFFPIDEVTLGYLKLTGRQSDRIALVEAYSKAQGLWRNAGDEP
VFTDTLSLDMSTVQASLAGPKRPQDRVLLSEVPKTFNALMELTLKPAKEAKERLENEGGG
GTAVEATKANIQHESPSCVIEGQEYPLNHGDVVISAITSCTNTSNPSVMLAAGLLAKKAI
EKGLQRKPWVKSSLAPGSKVVTDYLLAAGLTPYLDELGYNLVGYGCTTCIGNSGPLPEPI
EDAIQCHDLNVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYGLVGNIRTDLTTQPIGQ
GKDGQPVYLKDIWPSQAEIDAVLQKVNTDMFHKEYAAVFDGDESWQAIQIPKSKTYEWAD
DSTYIRHPPFFEGIGEPPKPIKNIEQARILAVLGDSVTTDHISPAGNIKKDSPAGRYLQE
QGVEPKDFNSYGSRRGNHEVMMRGTFANIRIKNEMLGGEEGGNTIHVPSGEKLAIYDAAM
RYQQEHTPLVIIAGKEYGTGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQ
FVDGQTRQSLNLTGHEVISIRGLSDGIQPHEILEVDVKGPNGVASHFNVLCRIDTLNEVE
YFKAGGILHYVLRNLIPS
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtatagcaatatcaatagttttaatgctttacagacgctaacagtaggttcc
agcaattatcagatttttagcttaacccaagccgagaaaaagctaggtgacattgccaaa
ctgccgaaatcattaaaagtactgttggaaaacttattacggtttgaagatcagcacagt
gttaaaacagaacacatttatgctttagctgagtggctaaaaacccgtacctcagatcaa
gaaattcaatatcgacctgcacgggttttaatgcaagattttaccggcgttccggcagtc
gttgacttagccgcaatgcgtgctgcaatggctgaagcggggggtgaccctgaaaaaatt
aatccgttatcacctgtagatctggttattgaccactctgtgatggtagaccattttgcc
gatgatcaggcttttgaagaaaacgttcaaattgaaatgcagcgaaatggcgagcgatat
caatttttacgttggggacaatctgcatttaataactttagtgttgtgccaccgggtacc
ggtatttgccatcaggtcaatttagaatatttggctcaagcagtgtggctaggtgaagac
aacggacagacctttgctttccctgacaccttagtgggtacagactcacataccaccatg
attaatggtctaggggtattaggttggggtgttgggggtattgaagcagaagctgccatg
ttaggccaacctatttctatgctcattcctgaggtgatcggttttaaactgactggaaaa
ttacaagaagggattacggcaactgacttggtgctcaccattactcaaatgcttcgccaa
aaaggtgtggtaggtaaatttgtagaattctatggcgatggtctagccgatttaccactt
gctgaccgtgcaaccattgccaatatggcgcctgaatatggtgcaacttgtggtttcttc
ccaattgatgaagtgactttgggttatttgaaattaacaggtcgtcaaagtgaccgtatt
gcattggtggaagcatatagcaaggcgcaaggtttatggcgtaatgcgggtgatgaacct
gtgtttacagatacgttaagtttagatatgagtacggttcaggcaagtttggcaggtcca
aaacgccctcaagaccgtgtgcttttatcggaagtacctaaaacgtttaatgcgctcatg
gaattaacccttaagccagccaaagaagcgaaagaacgtttagaaaatgaaggcggtggc
ggtacggctgtagaagcgaccaaagccaatattcagcatgaaagcccatcttgtgtaatt
gaaggacaagaatatccgttaaatcatggtgatgtcgtcatctcagcaattacttcatgt
accaatacttctaacccaagtgtaatgttggcagccggtttacttgctaaaaaagcaatt
gaaaagggtttgcagcgtaaaccgtgggtaaaaagttcacttgcgcctggctctaaagtc
gtgaccgactatttattggcggctgggcttacgccgtatttagatgagttgggctataac
ttggtcggatatggttgtacaacgtgtattggtaactcaggtcctttacctgaaccaatt
gaagatgcaattcagtgtcatgatttaaacgtggcatctgtactttcgggtaaccgtaac
tttgaagggcgtgtgcatccattagttaaaaccaactggcttgcctcaccaccacttgtg
gtggcctatggtttagttgggaatatccgtacagacttaacgactcaaccaatcgggcaa
ggtaaagatgggcaacctgtttacttaaaagatatctggccaagtcaggcagaaattgat
gccgtcttacaaaaagtaaataccgacatgttccacaaagaatatgctgcggtgtttgat
ggtgatgaaagctggcaagcgattcagattccaaaaagtaaaacttacgaatgggctgat
gactcgacctatattcgtcatccgccgttctttgagggtattggtgagccaccaaaacca
atcaagaatattgaacaggcacgtattttggcagtgcttggtgactcggtaacaaccgac
catatttcaccagcgggtaatatcaaaaaagacagtccagctggccgctatttacaagag
caaggtgttgagccaaaagacttcaactcttatggttcacgacgtggtaatcacgaagtc
atgatgcgaggcacctttgccaacattcgtattaaaaacgaaatgctcggcggcgaagaa
ggtggtaataccatacatgtgccaagtggagagaagcttgctatttatgatgcggcaatg
cgttaccaacaagaacatacaccgcttgtgattattgctggtaaagaatacggaacaggt
tcttcacgtgactgggctgccaaaggaacgaacttgttaggtgtaaaagctgtcattgcg
gaaagttttgaacgtattcaccgttcaaacttggtgggtatgggcgtgttgccactccag
tttgttgatggccaaaccagacagtccctcaacttaacgggtcatgaagtcatttcgatt
cgtggtttatcggatggtattcagcctcatgaaattcttgaggttgatgtgaaagggcca
aatggggtagcaagtcattttaatgtgttatgtcgaattgatacgttaaatgaggtggag
tactttaaggctggtggtattttgcattatgtgctgcggaatttgattccttcataa

KEGG   Acinetobacter baumannii AB0057: AB57_2462Help
Entry
AB57_2462         CDS       T00793                                 

Definition
(GenBank) bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00020  Citrate cycle (TCA cycle)
abn00630  Glyoxylate and dicarboxylate metabolism
abn00640  Propanoate metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01200  Carbon metabolism
abn01210  2-Oxocarboxylic acid metabolism
abn01230  Biosynthesis of amino acids
Module
abn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
abn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AB57_2462
   00630 Glyoxylate and dicarboxylate metabolism
    AB57_2462
   00640 Propanoate metabolism
    AB57_2462
Enzymes [BR:abn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     AB57_2462
    4.2.1.99  2-methylisocitrate dehydratase
     AB57_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase
Motif
Other DBs
NCBI-ProteinID: ACJ42573
Position
complement(2551577..2554216)
Genome map
AA seq 879 aa AA seqDB search
MLEAYRQHVAERAALGVPPKPLDDAQTAQLVELLKNPPAGEEAFLVDLLENRVPAGVDQA
AYVKAAFLAAIAKGEATSPLVSKERAVYLLGTMLGGYNVAPLVELLDDAELGSLAAEALK
KTLLVFDAFHDVADKAKAGNANAKAVLQSWADAEWFTSRKDVPEEIKITVFKVTGETNTD
DLSPAQDAWSRPDIPLHANAMLKNERDGINPEKPGEVGPLSQIKELIAKGNQVAYVGDVV
GTGSSRKSATNSVLWFFGDEIAHIPNKKDGGVCLGGKIAPIFFNTMEDAGALPVEIDVSN
MNMGDEVTLKIDHAAAKVTAFKNGEQIAESELKTPVLLDEVRAGGRINLIIGRGLTAKAR
EALGLAPSTLFRTPVQPADTGKGFTLAQKMVGRACGLPEGQGIRPGTYCEPKMTTVGSQD
TTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVQMQHTLPDFIMNRGGVSLRPG
DGIIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVK
FKGKMQPGITLRDLVHAIPYYAIKEGDLTVEKKGKKNIFSGRILEIDLTEMETDLTVEQA
FELSDASAERSAAGCAITLSEEKVAEYLRSNITMLKWMISQGYGDARTMARRVENMEKWL
ANPSLLKADADAEYTKVYEIDLSEIKEPILCCPNDPDDAKLLSDVQGDKIDEVFIGSCMT
NIGHFRAAGQLLEKVPSGSLTTRLWLAPPTRMDEHQLMEEGFYNTYGRAGARTEMPGCSL
CMGNQARVAPNTTVVSTSTRNFPNRLGQGSNVYLASAELASVAAVLGKLPTPEEYQQYAA
QIDSMSADIYKYLNFDQMGEYTNAADKVDTKKIAAAQLT
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
gtgctagaagcttaccgccaacacgttgctgaacgtgccgcactcggagtcccaccgaag
ccacttgatgatgctcaaactgctcaacttgttgagttattaaaaaacccaccggcaggt
gaagaagcattcttggttgatttgcttgaaaaccgtgttcctgcaggtgttgaccaagca
gcttacgtaaaagcagctttcttggcagcgattgcaaaaggcgaagcgacatctccgcta
gtttctaaagaacgtgcagtttatttactaggtacgatgcttggtggctataacgtagcg
cctttagttgagcttctggatgatgctgaattaggtagcttagctgctgaagctttgaaa
aaaacattacttgtatttgatgcgttccatgacgtagctgataaagctaaagctggcaat
gcaaatgcaaaagctgttttacaatcttgggctgatgctgaatggttcactagtcgtaaa
gatgtaccagaagaaatcaaaatcactgtgttcaaagtaacaggtgaaacaaacactgat
gacttgtctcctgctcaagacgcatggagccgtccagacatcccattgcatgcaaatgca
atgttgaaaaatgagcgtgatggtatcaaccctgaaaaaccaggtgaagttggtccatta
agccaaattaaagaactcattgctaaaggcaatcaagttgcttatgttggtgacgttgtt
ggtacaggttcatctcgtaaatctgcaacaaactctgttctttggttctttggtgatgaa
atcgctcacattccaaacaaaaaagacggtggtgtgtgcttaggcggtaaaattgctcca
atcttctttaacacaatggaagatgctggtgcgttaccagtagaaatcgatgtttctaac
atgaacatgggtgacgaagttactcttaaaatcgatcatgctgctgcaaaagttactgcg
ttcaaaaatggcgaacaaatcgctgagtctgaacttaaaactccagtacttttagatgaa
gtacgtgctggtggtcgtattaacttgattattggtcgtggcttaactgctaaagcacgt
gaagctttaggtttagctccatctacattattccgtactccagtacaaccagctgacact
ggcaaaggtttcactttagctcagaagatggttggtcgcgcatgtggtctcccagaaggt
caaggtatccgtccaggtacttactgtgaacctaaaatgactacagttggttctcaagat
acaactggtcctatgactcgtgatgagttaaaagacctagcttgcttgggcttctctgct
gacttagtaatgcagtctttctgtcatactgctgcttatccaaagccagttgacgtacaa
atgcaacatacacttccagacttcatcatgaaccgtggtggtgtatctttacgtccaggt
gacggtattatccactcttggttaaaccgtatgcttcttccagatacagtaggtactggt
ggtgactcgcatactcgtttcccaattggtatttcattcccagcaggttctggtcttgta
gctttcgctgctgcaactggtgtaatgccacttgatatgcctgaatcagttcttgttaag
ttcaaaggtaaaatgcagcctggtatcactttacgtgaccttgtacatgcgattccttac
tatgcaatcaaagaaggcgatcttactgttgagaaaaaaggtaagaaaaacatcttctct
ggtcgtatcttagaaatcgacttaacagaaatggaaactgacttaacagttgagcaagca
ttcgaactttctgatgcttctgctgaacgttcagctgctggttgtgcaatcacactttca
gaagagaaagttgctgagtacttacgttctaacatcacaatgcttaagtggatgatttca
caaggctatggtgatgcacgtacaatggctcgccgtgttgaaaacatggaaaaatggtta
gcaaacccaagcttacttaaagctgatgctgatgctgaatacactaaagtgtatgaaatt
gacttgtcagaaatcaaagaacctatcctttgctgcccgaacgatccagatgatgcgaaa
cttctttctgacgttcaaggcgacaaaattgatgaagtattcatcggttcttgtatgact
aacattggtcacttccgtgctgctggtcagttacttgagaaagtaccaagcggttcatta
acaactcgtttatggttggctccaccaacacgtatggatgaacatcagttaatggaagag
ggcttctataacacttatggccgtgctggtgcacgtacagaaatgcctggttgttcatta
tgtatgggtaaccaagcacgtgttgcgccgaacacaactgttgtttcgacttctacacgt
aacttccctaaccgtttaggccaaggttctaacgtttacttagcgtctgctgagcttgca
tctgttgctgctgtacttggtaaattaccaactccggaagaataccaacaatatgcagct
caaattgacagtatgtctgctgacatctacaaatatttgaatttcgaccaaatgggcgaa
tatacaaatgctgctgataaagtagatactaagaaaattgccgctgctcagttgacttaa

DBGET integrated database retrieval system