KEGG   Acinetobacter baumannii AB0057: AB57_0883Help
Entry
AB57_0883         CDS       T00793                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00900  Terpenoid backbone biosynthesis
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB57_0883
Enzymes [BR:abn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AB57_0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACJ40677
UniProt: B7I7P3
Position
complement(939832..940665)
Genome map
AA seq 277 aa AA seqDB search
MIRVPSPAKLNLFLHITGRRENGYHELQTIFQLIDLYDWMTFTPISEDEIQIEGLGEVQL
EQNLIYRAAQILRPHAQNPCGLHIKIEKNIPMGAGLGGGSSNAATTLIVLNQLWQCGLTE
EQLAQFGVKLGADVPIFIYGLNAWAEGIGEHLSFIDLDQKQFIVLKPDCFISTQLLFSQK
TLTRDSKPTTFCAYQLEPSNFGNNFEPLARELYPEVEEAMQYLDQFGHAKLTGTGACVFA
EVTDEMNVDDILKHAPCKAYLVHSLKESPLRHFKVAS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagtaccttctccagctaagctcaacctgtttttgcatatcacaggacgtcgt
gaaaatggttaccatgaactacaaaccattttccaacttattgatttatatgactggatg
acatttacgcctatatctgaagatgagattcagattgaaggtttaggtgaggttcaactt
gagcaaaatctgatttatcgggcggcacagatattacgccctcacgctcaaaatccttgc
ggactccatataaaaattgaaaaaaatattccgatgggtgctggtttaggtggcggttct
tccaatgcagcaacgacgcttattgtcttaaatcaattatggcaatgtggtctaactgaa
gaacaattagctcagttcggtgtcaagcttggtgccgatgttccaatttttatttatggg
ttaaatgcatgggctgaagggattggtgaacatttatcattcatagacttagatcaaaaa
caattcattgttttaaaacctgattgttttatcagcactcaactgcttttttcacaaaaa
acattgacaagagattctaagcccactacattttgcgcctatcagttagaaccttctaat
ttcggaaataactttgagcctttggctagagagttataccctgaagttgaagaagcaatg
caatatctcgaccaatttggtcatgcaaagcttacaggtacaggtgcttgtgtttttgct
gaggtaaccgatgaaatgaatgttgatgacattcttaaacatgcaccatgtaaagcttac
ttggtacatagtttaaaagaatctcctttacgtcattttaaagttgcaagttag

DBGET integrated database retrieval system