KEGG   Acinetobacter baumannii AB0057: AB57_1050Help
Entry
AB57_1050         CDS       T00793                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
abn  Acinetobacter baumannii AB0057
Brite
KEGG Orthology (KO) [BR:abn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AB57_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACJ40840
Position
1117208..1118839
Genome map
AA seq 543 aa AA seqDB search
MNSNLPPVSDSKLAANLQAKSTNVHVPTPKFFMPVFLTIIIATLIYIGFQVSADLAHVPP
LSLYSVILLSTALLIALGFEFVNGFHDTANAVATVIYTNALPAPVAVMWAGFCNFLGVMV
ASGAVAYGIIALLPVELIMNMGSGAGFAMVFALLIAAILWNLGTWFLGIPASSSHTLIGS
ILGVGIMNHLLSASTGVTTSGVDMDQVIKVGKALLFSPLIGFAFAAIVFLLVKTIFKRQL
ELFQPPEGNKPPPAIIRAILIFTCTGVSFAHGSNDGQKGMGLIMLILVGLVPLAYSLNKN
LDTQQVQSFHQLSSQTAVLLNQNQPELTDEKARAVLTKYIQTKQQTPEVVPALASMTDHL
GERVSSYSNLKDIPEAAISEIRNDMYLSTTTFKRLDKADALPKMDDSQKKLVKDYRSSLD
SFLQYIPNWVKVAVALALGLGTMVGWKRIVVTVGERIGKHHMTYGQGMSAELVAMSTIAA
ADGLGMPVSTTHVLNSAVAGTMVANKSGLNFNTVKTILSAWVFTLPATICLSGGLYWLFL
QFV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaatctaccccctgtttcggattcaaaacttgcggcaaacctgcaagcaaaa
tcgacgaatgtacatgtcccgacacctaagttttttatgccggtgtttctgacgattatt
attgcaacacttatttatattgggtttcaggtcagtgctgatttagcgcatgttccacct
ttaagcctttattcagttattcttttatctactgcactcttgattgcactaggctttgaa
tttgtaaacggtttccacgacactgctaatgcagttgcaacggttatttatacaaatgct
ttgcctgcaccggttgcagtcatgtgggcaggtttttgtaatttccttggggtaatggtc
gcaagtggtgctgttgcgtatggcattattgcattgcttccagttgaacttattatgaac
atgggcagtggtgctggctttgcaatggtttttgcattgttgatcgctgcaattctttgg
aatcttggtacttggttcttgggaattcctgcttctagctctcataccttgattggttca
atcttaggtgtgggtattatgaatcatctgttgagtgcatcgactggcgtaacgaccagt
ggtgttgatatggatcaggtgattaaagtaggtaaggcattattattttctcctttaatt
ggttttgcttttgcggcaattgtattcttgttggttaaaactattttcaaacgccaatta
gaattattccagccacctgaagggaataagccaccaccagcaatcattcgtgcaattctt
atctttacctgtacaggtgtgagttttgcacatggttctaatgatggccaaaaaggtatg
ggtcttatcatgcttattttggttggtttggtgccattagcttattcattaaataaaaac
ctcgatacacagcaggttcaatcattccaccagctttcttctcaaactgcggttttgtta
aaccaaaatcaaccagaattgactgacgaaaaagcgcgtgcggttttaactaaatacatt
caaaccaaacaacaaacgcctgaagttgtgcctgcattggcaagcatgactgaccatttg
ggtgagcgtgtttctagctatagcaacttaaaagatattccagaagctgcaattagcgaa
atccgtaatgacatgtatttgagcacaacgacgtttaagcgtttggataaggcagatgct
ttaccaaaaatggatgactcacagaaaaagcttgtgaaagattatcgtagtagcttggat
tcattcttacaatacattccaaactgggtgaaagtggcagtcgcattagcgcttggactt
ggtactatggttggttggaaacgtattgtggtaactgtcggtgagcgtattggtaagcat
cacatgacttatggtcaagggatgtctgctgaacttgttgcaatgagtacaattgctgca
gcagatggtttaggtatgccggtttcaacaacacacgttttaaacagtgctgttgcaggt
actatggttgccaataaatcaggcctgaatttcaatactgtaaaaacaattctctctgca
tgggtatttacacttcctgcaaccatctgtttgtctggtggtctatactggttgttctta
cagtttgtataa

DBGET integrated database retrieval system