KEGG   Acinetobacter baumannii AB0057: AB57_1479
Entry
AB57_1479         CDS       T00793                                 

Definition
(GenBank) type VI secretion system-associated protein
  KO
K11901  type VI secretion system protein ImpB
Organism
abn  Acinetobacter baumannii AB0057
Brite
KEGG Orthology (KO) [BR:abn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abn02044]
    AB57_1479
Secretion system [BR:abn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AB57_1479
SSDB
Motif
Pfam: T6SS_VipA DUF29
Other DBs
NCBI-ProteinID: ACJ40497
Position
1559447..1559950
AA seq 167 aa
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDK
KFINVDLDNIDEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPL
KKLVEARERLTDLRNKISNSERLEDLLDEVLKNTDQIRKLSAEADHE
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctaagagagaaagcgtacaaaagaagcttcagcgaattcgacctccacgtgttcag
cttacatatgatgtcgaaattggtgatgcgaaagaagcgaaagaactaccattcgttgta
ggtgtaatgggtgatttttcagctgcatctgagcttgagcgtacaaaattaaaagataaa
aaattcattaatgtcgatttagataatattgatgaagtaatggaatctctgtctccaaga
gctgcttttcaagtagacaatacgttgacagaagaaggcggtaaaatggctgttgattta
acgtttaagtcaatggaagattttcgcccggaaaatgttgtacagcaagttgatccatta
aagaaattggttgaggcgcgtgagcgtttaaccgatttaagaaacaaaatttcaaacagt
gagcgtttagaagacctgcttgatgaggttcttaaaaatactgatcaaatccgtaaatta
agtgcggaggccgatcatgaataa

DBGET integrated database retrieval system