KEGG   Acinetobacter baumannii AB0057: AB57_1486
Entry
AB57_1486         CDS       T00793                                 

Definition
(GenBank) type VI secretion protein
  KO
K11891  type VI secretion system protein ImpL
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AB57_1486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abn02044]
    AB57_1486
Secretion system [BR:abn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AB57_1486
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C MMR_HSR1 DUF4381
Other DBs
NCBI-ProteinID: ACJ40504
Position
1566763..1570587
AA seq 1274 aa
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQ
RKKHAVQGEELAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAAL
YELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDT
AGRYSVYSEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNLRAR
IQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDL
FEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFIATLFEDNPYQ
FQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNK
VVQLEKSSGQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLK
GVKQIVLIPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNA
LKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDK
QFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVSQIVGDANKNI
VLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQL
TALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRTLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQ
GKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAV
GFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSAS
LQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQFVMNFQRY
VAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVN
FIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTD
PSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPVKTEN
PVSALAQPAAGVKP
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgcatacaattttaggctacttgtggcagtacatcacgaatcctaaagcaattatcgcc
ttgtcattgttcgtggcattgatgtcttcctatacttcaattcctcgccatatattttgg
gctttagcatctgcatatgctttagggctcatcgcttatggaatttattggctaattcag
cgtaaaaagcatgctgtccaaggtgaagaacttgcgcaagcgattgaaaaggatacacaa
gcagagtacggcaaaaataaagataaagaagagctgcaacttattagccaacaaatgaaa
gaatctattcaattgattcgtaagtcaaagctaggcgataaaaaggggaacgcagcacta
tatgagttgccatggtatatggtcattggtaacccggctgctggtaaaagttctgcgatc
tataattctggtttaaagtttccttttgaagaaacccatcaaaaaatggtttcggctggt
ttaagcggtacgcgtaattgtgactggtttttttcgactgagggtattttactcgacact
gctggacgttattcggtctatagtgaagatcactctgaatggttaggctttttaaatatc
ttaaagaagaaccgttctaaggctccagtaaatggtttaattcttattgttagtattgct
gagcttgttagtcagagtcctgaacactcattaaagcttgcgaaaaatttacgcgctcgt
attcaggatttaaccgaacgtttagaagtggttgtacctgtatatctagtcttttcaaaa
atggatttgatcgcgggttttaccgaatttttcgaattctatgaagcacaagaatataat
caggcgtggggcgcaacactaccatatgagcaaaactcttctcataatgctgtagatctt
tttgagaaacactacaatattctttatgacggtttaaaaggggtcagttcaactcatctt
agccgtcgacattctcaaaatatctcacctagtgtgatgactttcccattagaatttaag
acattaaaacctgcattaaaaagttttattgcgacactgtttgaagataacccttaccag
ttccaaccagttttccgtgggttttatttcacaagtgctttgcaagaaggcgtaatagaa
agtccaatgactgagcaaattgcacaggaattccagctttcccaaattgctcaaagtgaa
gtaaaagatcaactaaaaacaacgcctaaccatggttatttcttaaaaggcttgttttca
gatgtcattttaaaagataaagatctggttaaacagcatgtcaatacaagcaaaaagcgt
cagcgttatattgcatttattggtgctttagctggcgtatccattattctaggtgtgtgg
gtttggtcatatcgtaacaatcaacaacttattgctgaagttcaagctgatttaaataaa
gttgttcaattggaaaagagttcaggtcaacaattgtcgactcaattagaggccttactt
atcttgcaaagacgtctacaacagttagatgaatttgatgaaaatagaccactaaaattt
agttttggtttatatcaaggtaatgagctacgtgaaaaattaaaagctgaatatttaaaa
ggtgttaagcaaattgttttgatacctacacagcaaaatattgctcagtatttgcaacgt
gtaaaaaataacgaagcaactttaaaagcaaatcataccaatgttgagatcaagcaaact
gctcaaactcagcaatatttagagccttcggataccaaccctcaagatgcttataatgct
ttaaaagcatatttaatgatgagcaatccacagtatatggatgcgagtcacttaagtgat
caggtaacgcgtttctggcgttcttggcttgatgccaataaagggcagatgccacgtgca
gatatgattcaagaagctgagcagatcttatcttatgcaatgacattggcaaatgataaa
caattcccgatcttggatgctgactctcaacttgtagatcagacacgtcaagtattgctc
tctgttattagaggtatgccagcacgtgaccgtgtttataatgaaattaaaatgcgtgct
gctgtgcgcttcccagctttaactgtgagccagattgttggtgacgcaaataaaaatatt
gtattgggtagttatgcattaccaggggtatttactcaaaaagcttggaacgagtatgta
gaaaaagcaattgaggaagcagcagacaaacctacggatactaaagactgggtgcttaat
agccgtcaatctgatgatttaactttctcaggtagtccagagcaaattagaaagcagctt
actgcattgtataaacaagaatatattgcagagtggagaaaattcttaagtggtattcac
tatgcaaaagcaactcagtttgctcagcaagttaaaaatattgatgtattgggcgaacca
caaaattcaccaattcgcacacttattgaacgcgtagccattgaaacaaattgggataat
ccggtcgttcaagccgagttagcagcacctcaaaaaggatttattgcatggtttaaacgt
aaggttttaaaccatgatgataaacaattagcaaatcaggctgtaacgaatgctcaaggg
cctatttctcaagaatatcaaatgttctatcaattggttcgtaaacgtgatgatcagcaa
ggtaaatctttgcttgatgaatatatgacgaatcttgccttagtacgtagtaagtttaat
gaacttaagaatgcgggtgagatcggaccgaatgcgatgacattggttaagcaaacttta
aatgagcagacatcggtatttaaccagactcaaaaaattgtagatgaaaagatggcggtt
ggtttcagtgaaattgatcagcaacttctacaaaaattagtggtgagtccacttacccaa
gcctttgaaagtttaattacacctactcaagatgaaattaataagctatgggtaatgcaa
gcttatcaaccatttactgcaaatcttgctaagaaatatccatttaactcatcagcttct
ttacaagcaacaagtagtgaaattggacaaattcttggtgaaaacggcagtatttcccgt
tttgttaaagagagtttagatccgtttgttatccgccgtggttataccttaacctcaaaa
acatggaaagatttggggattagtttaaacccacaatttgtcatgaacttccaacgctat
gtcgcacctacaaatggaatggcaacaggtgagttaaatagccaagcaccagctgctccg
gcaaccaatcagtctaacttccagttctacccaattcaaaacccgcagttactttcatat
accgttgatattgatggtcagcgtatgacttatgaaaatggggtacagcaatgggttaac
tttatttggccaaatcaaggcagtattccgggtgctcgtattacggctgtagatttacaa
ggtcaaacacataccatttttgatgaaccaggcgaatacgggattaaccgtttaatcgat
agtgcacagcgtaaagagcaaaacggtggttttgaaatgctttggcgcagtaagacagat
ccatcactctttgtgaaaatgaacttccgtcttattagtagtaattcaggaagtatcggt
tcaagccgtggctactctggtatgcaactggtggacaaagtgactgcggataaagctgct
cgcgttgtatccgcacagcaagcaccagctcaagctgctgctcctgtcaaaactgaaaat
ccagtttctgcactagcacaacctgctgcgggagttaagccatga

DBGET integrated database retrieval system