KEGG   Acinetobacter baumannii AB0057: AB57_1589Help
Entry
AB57_1589         CDS       T00793                                 

Definition
(GenBank) 3-oxoadipate CoA-transferase
  KO
K01032  3-oxoadipate CoA-transferase, beta subunit [EC:2.8.3.6]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00362  Benzoate degradation
abn01100  Metabolic pathways
abn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB57_1589
Enzymes [BR:abn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     AB57_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ACJ40980
Position
1674891..1675544
Genome map
AA seq 217 aa AA seqDB search
MSVQKRSREDIAKLIANDIPEGSYVNLGIGLPTNVAKFLPKDKEIFLHSENGVLAFGPPP
QPGEEDQDLVNAGKELVTLLDGGCFMHHGDSFDIMRGGHLDICVIGAFQVAVNGDLANWH
TGKADDVPAVGGAMDLAVGAKTIYVYMEHVTKKGEPKIVKELSYPITGEQCVNRIYTDLC
IIELKDQKAYVKEMVDGLTFDELQAVTDCELIDARVA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcaaaagcgttctcgtgaagatattgccaagctcattgccaatgacattccg
gaaggttcttatgtcaatttaggcattggtttaccgaccaacgttgctaaatttttgcca
aaagacaaagaaatctttttacattcggaaaatggggttttggcttttggtccaccacca
caacctggtgaggaagatcaagatttggttaatgccggaaaagaacttgttactttgtta
gacggcggatgctttatgcatcatggcgactcatttgacattatgcgtggcggccatttg
gacatttgtgtgatcggtgcattccaagttgcggtaaatggagacttggcaaactggcat
accggtaaggcagatgatgtgccggcagttggcggtgctatggatttggcagtcggtgca
aaaacgatttatgtctatatggagcatgtcactaaaaaaggtgagcccaaaattgtaaaa
gaactgagctatccaataacgggtgagcagtgtgtaaaccgtatttataccgatttatgc
attattgaactcaaagaccaaaaagcttacgtcaaggaaatggtagacggcttaactttt
gatgaattacaggcagtcactgactgtgaactaatcgatgcacgtgtagcctaa

DBGET integrated database retrieval system