KEGG   Acinetobacter baumannii AB0057: AB57_1910Help
Entry
AB57_1910         CDS       T00793                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AB57_1910
DNA repair and recombination proteins [BR:abn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AB57_1910
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AB57_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Toprim_2
Motif
Other DBs
NCBI-ProteinID: ACJ41288
Position
1998863..1999459
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatcttttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcatgaaatttgtgatatttgcgcttcaacagaaagagatgatcaattg
ctttgtgtagttgagtctccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtggacacctttctccattagatggaatcgggccagaagaa
ataggcattccttatctaatccaacgtttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcacatgacacgtattgctcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

DBGET integrated database retrieval system