KEGG   Acinetobacter baumannii AB0057: AB57_1930Help
Entry
AB57_1930         CDS       T00793                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00010  Glycolysis / Gluconeogenesis
abn00020  Citrate cycle (TCA cycle)
abn00620  Pyruvate metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01200  Carbon metabolism
Module
abn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_1930
   00020 Citrate cycle (TCA cycle)
    AB57_1930
   00620 Pyruvate metabolism
    AB57_1930
Enzymes [BR:abn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AB57_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACJ41305
Position
2016254..2017789
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRK
ILAKDGDTLPVGGLIAVCADSEISNAEIEKFIASLGGSAAKAPEASSEQSKSETFAPVAE
KAEQPQSVAASAPAPTKVAKGDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVRG
SGREGRISVQDIQKAVQAAGGQWPDVKQQTQAKVIKSTADDSQVLATPVARRLAKQWGIN
LNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQSAQCAAQPQSTITTVAMNGMRKVIASR
LQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNV
QFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQ
PDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATL
SCDHRVIDGAVGAKFLASFKQFVENPALILV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaaaacgctggagatcccgaaatggggattatctatggaagaaggcacg
atcgcccaatggttgattaaagagggtgatagctttaataagggcgatgaaatttgtgaa
attgaaaccacaaaaatcgtcaatgtattagaagcaccttttgctggaacgctccgtaaa
attttagcgaaagatggtgatactttacctgttgggggtcttatagccgtatgtgctgat
agtgaaatttctaatgcagaaattgaaaaatttattgcatcactaggtggttcagcagct
aaggcccctgaagcatcttcggaacaaagtaaatcggaaacatttgcacctgttgctgaa
aaagccgaacaaccacagtccgtagctgcaagtgctccagctcctacaaaggtagcgaaa
ggtgactacgctgtaccagagtcattacaaggctatcaaacatctgatgagttgtttgca
acgccacatgcgttaaagcttgcagaaaagcacaatgtgaacttggcaaaagtcaggggt
tctggtcgtgaaggacgtattagtgttcaagacatccagaaagctgtgcaggctgctggt
ggtcagtggcctgatgttaagcagcaaactcaagctaaagtgattaaatctacagccgat
gatagccaagttttagcgacacctgtagcacgtcgtttagcaaaacaatggggtattaac
ctaaatgactgccgtgtttcaggtactcgtggccgtgtctgcaaagaagatgttgaagca
gtttactatcgtaacaatccaacgtcggtaaatgaacaatctgctcaatgtgcagctcaa
ccacaatcaacaattacgactgtggcgatgaatgggatgcgtaaagtgattgcttcacgc
ttacaagctgcaaaacgtaatgcaccgcatttccgcttagtggtcgatctcaacgtagag
gctttgcaaaaattacgtaagcagattaatgaaacggttcctcaagtcaaactttctatt
aatgacatgctaattaaagcagctgctgcggcactgattaaagtgcctgaggtgaatgtt
caatttgatgaggcgactcaatcaattttacagttctctcaagcggatatttcggtggcc
gtagcgattccaaacggtttaattacacccattgtaaaagcagcgaatcagaagtcttta
gcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaagactggcaagttacaa
cctgacgagtttcagggaggcagctttagcatttcaaatttaggaatgttaggcattaaa
cagttcgatgccattattaacccaccgcaaggtgcaattatggcattaggtgcttcggaa
tctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagattgtcacagcgacgttg
tcatgcgatcaccgagttattgatggcgcagttggggcgaaattcttggccagctttaag
cagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system