KEGG   Acinetobacter baumannii AB0057: AB57_1960Help
Entry
AB57_1960         CDS       T00793                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00071  Fatty acid degradation
abn00072  Synthesis and degradation of ketone bodies
abn00280  Valine, leucine and isoleucine degradation
abn00310  Lysine degradation
abn00362  Benzoate degradation
abn00380  Tryptophan metabolism
abn00620  Pyruvate metabolism
abn00630  Glyoxylate and dicarboxylate metabolism
abn00640  Propanoate metabolism
abn00650  Butanoate metabolism
abn00900  Terpenoid backbone biosynthesis
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01200  Carbon metabolism
abn01212  Fatty acid metabolism
abn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB57_1960
   00630 Glyoxylate and dicarboxylate metabolism
    AB57_1960
   00640 Propanoate metabolism
    AB57_1960
   00650 Butanoate metabolism
    AB57_1960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB57_1960
   00072 Synthesis and degradation of ketone bodies
    AB57_1960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB57_1960
   00310 Lysine degradation
    AB57_1960
   00380 Tryptophan metabolism
    AB57_1960
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB57_1960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB57_1960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB57_1960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abn04147]
    AB57_1960
Enzymes [BR:abn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB57_1960
Exosome [BR:abn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB57_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACJ41334
Position
complement(2049313..2050485)
Genome map
AA seq 390 aa AA seqDB search
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGVKPEQVDEVIFGCVLSAG
IGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTN
APYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDDFAI
SSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVVDQDEQPLKANLEKIPTLRPAFSKDGTI
TAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLE
RAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNVHGGACALGHPIGATGSRIILSL
IYALKRLGKKKGVAALCIGGGEATAVAIEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattgttatagtttcaggtagccgtactgcaatgggtggttttcagggtagt
ttatcttctctaactgctccagaacttggcgctgctgtcatccgtgaatcgatccaacgt
gcaggtgttaaacctgaacaggtggatgaagtgattttcggttgtgtactcagtgcaggt
attggtcaaggccctgctcgtcaagccatgcgcaaagctggcgtgcctgatcatgtcgga
gctgtgaccattaataaactttgcggctctgcaatgaaagcggtgttaatggcatcagat
acattaaaagcaggtagtgccaatattattgtggctggcggcatggaatctatgaccaat
gcaccttatattttgcctaaagctcgcggtggttatcgtatgggacacggcgaaattaag
gaccatatgtttttagatggcctcgaagatgcagaaacaggtcgtttaatgggttctttt
gctcaagacatggcaaataccaaaggctttacccgtgagcaaatggatgactttgcaatt
tcttcacttaaaaaagcgcaaactgcgattacggaaggttatttcaaagaagagattgtt
cctgttgaagtaaaaacccgtaaaggtgtcgaagttgttgatcaagatgagcaaccatta
aaagctaatcttgagaagatcccaacattgcgtcctgcttttagcaaggacggcacaatt
acagccgctaattcaagctctatttctgatggcgctgctgcattagtacttactactgaa
gaatatgctcaaagccatggtttaaatactttagcaaaaattgtggcaacttcgactcac
tctcagcatccaagcgaattcacaattgctccaattagtgcaattcagaaagtacttgag
cgtgctggttggtctgttgatgaagtagatgcttgggaaattaatgaggcttttgcgatg
gtggcaatggcaccaattcatgagctaggaattgatgaagcaaaagtaaacgtccatggt
ggtgcatgtgcattgggccatccaattggtgctacaggttcaagaattatcctttctctt
atttatgcattaaaacgcttaggtaaaaagaaaggtgtcgctgccctatgtattggtggt
ggtgaagcaacagccgttgcgattgaaatttaa

DBGET integrated database retrieval system