KEGG   Acinetobacter baumannii AB0057: AB57_2444Help
Entry
AB57_2444         CDS       T00793                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00633  Nitrotoluene degradation
abn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AB57_2444
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AB57_2444
  1.-  
   1.-.-  
    1.-.-.-  
     AB57_2444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Cytotoxic
Motif
Other DBs
NCBI-ProteinID: ACJ42555
Position
2536413..2537066
Genome map
AA seq 217 aa AA seqDB search
MDLLNTVKSRYTTKAYDPEKKIPQEKFNKLLEILRFTPSSVNIQPWHFLVADNPTAKERI
AKALTGRYAYNAPKVLESSHTLVFCTRTDISPEYLNQLLEQDDLSGRFKDEKAKLGQKDT
RHGYVEFYRNEQKNLFGWMENQTFIALGQLLFAAGLEGIDATPMGGFDEDVLNEEFGLKE
KGLRSSVIVSLGYRSENDFNAKLPKSRLPDEVIFTHL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatttattaaatacggttaaaagtcgctacactaccaaagcgtacgatcccgagaaa
aaaattcctcaagaaaaattcaataagttattagaaattttacgctttaccccttcttca
gtgaatattcaaccttggcatttcttggttgcagacaatcctactgctaaagaacgcatt
gccaaagccttaacaggacgatatgcctacaatgcccccaaggttcttgagtcatcacat
actcttgtattttgtacaagaacagatatttcacccgaatatttaaaccagttacttgaa
caagatgatttaagtggccgttttaaagatgagaaagccaaacttggtcaaaaggatact
cgtcatggctatgttgagttttaccgtaatgagcaaaagaacttattcggctggatggaa
aatcaaacttttatcgctttaggacaactactgtttgcagctggtcttgaaggcatagat
gcaaccccaatgggtggctttgacgaagatgttttaaatgaagaatttggcttaaaagaa
aaaggcttgcgtagctctgtaattgtttcactgggttatagaagcgaaaatgacttcaat
gcgaaattgccaaaatctcgtctgccggatgaagttatttttacacatttataa

DBGET integrated database retrieval system