KEGG   Acinetobacter baumannii AB0057: AB57_2658Help
Entry
AB57_2658         CDS       T00793                                 

Definition
(GenBank) histidine ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:abn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AB57_2658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abn02000]
    AB57_2658
Transporters [BR:abn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AB57_2658
   Histidine transporter
    AB57_2658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF1440 DUF1514
Motif
Other DBs
NCBI-ProteinID: ACJ42762
Position
complement(2750130..2750819)
Genome map
AA seq 229 aa AA seqDB search
MSFSGYGPLLLSGTWMTIQLALLSLLLSVIIGLIGASSKLSNIKALRYVATAYTTLIRSV
PDLVIMLLLFYSLQLGLNQITEALQMDQIDINPFVAGVITLAFIYGAYFTETFRGAFQSV
PRGQIEAAMAYGMTPWQVFHRVLFPQMMRFALPGIGNNWQVLIKATALVSIIGLTDIVKI
TQDAGRSTMQLFFFSIVAAAIYLAITTVSNLILIWLERHYSAGVRKGQL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttctggctatgggccactccttcttagcggaacatggatgaccatacagctt
gcgctgttatcactcttgctttctgtcattattggcttaattggtgcgagttcaaaactc
tctaatattaaagccttacgttatgttgcaaccgcctataccacgctcatccgtagtgtg
cctgacttagtgattatgctgctgttattttatagcttgcagttgggcttaaaccaaatt
actgaagcactgcaaatggatcaaattgatatcaacccatttgtggctggtgtgattact
ttagcgttcatttatggtgcatattttaccgagacctttcgtggtgcatttcaatcggtt
ccaaggggacaaattgaagcagcaatggcctatgggatgacgccttggcaggtttttcac
cgtgtattattccctcaaatgatgcgttttgcattgcccggcattggtaacaactggcaa
gttttgattaaggcgaccgcattggtttctattattggcctgactgatattgtaaaaatt
acgcaagatgcaggtagaagtaccatgcaactgttctttttcagcatcgtcgctgctgcc
atttatttggcaattaccacagtgtcgaacctgattttaatatggcttgaacgtcattat
tctgctggtgtgaggaagggacaattatga

DBGET integrated database retrieval system