KEGG   Acinetobacter baumannii AB0057: AB57_3085Help
Entry
AB57_3085         CDS       T00793                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00010  Glycolysis / Gluconeogenesis
abn00020  Citrate cycle (TCA cycle)
abn00620  Pyruvate metabolism
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
Module
abn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_3085
   00020 Citrate cycle (TCA cycle)
    AB57_3085
   00620 Pyruvate metabolism
    AB57_3085
Enzymes [BR:abn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     AB57_3085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-ProteinID: ACJ42417
UniProt: B7I624
Position
3194973..3196805
Genome map
AA seq 610 aa AA seqDB search
MTTVNAPEFVRHPKLIAWVEEIANLTKPAKIEWCDGSEEEYQRLIDLMIANGTMQKLNQE
KHPGSYLANSDPSDVARVEDRTYICSQNKEDAGATNNWEDPAVMREKLNGLFEGSMKGRT
MYVVPFSMGPLGSHIAHIGIELTDSPYVAVSMRKMARMGKAVYDVLGTDGEFVPCVHTVG
APLAEGQKDVAWPCNPEKYIVHYPETREIWSFGSGYGGNALLGKKCLALRIASVMGREQG
WLAEHMLILGVTNPQGEKHYIAAAFPSACGKTNFAMLIPPAGYEGWKIETVGDDIAWIKP
GEDGRLYAINPEAGFFGVAPGTNTKTNPNCMATLHKDVIYTNVAVTDDGQVWWEGLSKEV
PANLTNWKGQPHVNGEKAAHPNARFTVAAGQCPSIDADWENPAGVPISAFIFGGRRADTV
PLVSEAFDWVDGVYKAATMGSETTAAAVGQQGIVRRDPFAMLPFAGYNMADYFDHWLNLG
AKVSEKAEASGNKLPKIFNVNWFRRDAEGNFVWPGFGQNMRVLEWIIDRCEGRANAVETP
IGFVPTYEDLNWEGTEFTKEQFDLITNQDRDQWVTEIESHTELFNKLGERLPKALKERQA
ALLEAVKTGF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagtgaacgcaccagaattcgttcgtcatcctaagcttatagcatgggttgaa
gaaattgcaaacttaaccaaaccagcaaaaatcgaatggtgtgacggaagcgaagaagag
tatcaacgtctaatcgacttgatgatcgctaacggcaccatgcagaaattaaaccaagaa
aaacatcctggttcttatcttgcaaattctgacccatctgatgttgcgcgtgttgaagat
cgtacttacatctgctctcaaaataaagaagatgctggtgcgacaaacaactgggaagat
ccagctgttatgcgtgaaaaattaaatggtttatttgaaggttcaatgaaaggccgtacc
atgtacgttgttcctttctctatgggtcctttaggtagccatattgctcacattggtatc
gagttaactgactctccttatgtagctgttagcatgcgcaaaatggcacgtatgggtaaa
gcagtttatgacgtattaggtacagatggcgagtttgttccttgcgtacatacagtaggt
gctccacttgctgaaggtcaaaaagatgttgcttggccttgtaacccagagaaatatatc
gttcattacccagaaactcgcgaaatctggtctttcggttctggttacggcggtaacgcg
ttacttggtaaaaaatgtttagctcttcgtatcgcttctgtcatgggacgcgaacaaggt
tggttagctgaacacatgcttattcttggtgtaactaaccctcaaggtgaaaaacactac
atcgctgctgcattcccatctgcttgtggtaaaacaaactttgcaatgttaattccacca
gcaggttatgaaggttggaaaatcgaaactgtaggtgacgatattgcttggattaaacca
ggtgaagatggtcgcttatatgcaattaaccctgaagctggtttcttcggtgtagcacct
ggtacaaataccaaaactaacccgaactgtatggcaactcttcacaaagacgttatctat
acaaacgtagcagtaactgacgatggtcaagtatggtgggaaggtctttctaaagaagtt
ccagcaaacttaactaactggaaaggtcaacctcacgtaaacggcgaaaaagcagcacat
ccaaatgctcgtttcactgttgcagcaggtcaatgtccatctatcgatgctgattgggaa
aacccagcaggtgtgccaatttctgcattcatcttcggtggccgtcgtgcagatacagta
cctttagtttctgaagctttcgactgggttgacggtgtatataaagcggcaactatgggt
tctgaaactactgctgctgctgttggtcaacaaggtattgttcgccgtgacccattcgcg
atgcttccatttgctggctataacatggctgactactttgaccactggttaaaccttggt
gcgaaagtaagtgaaaaagctgaagcttctggcaacaaattaccaaaaatcttcaatgta
aactggttccgtcgtgatgctgaaggcaacttcgtatggcctggttttggtcaaaacatg
cgtgttcttgagtggatcattgatcgttgtgaaggtcgtgcaaacgctgttgaaacacct
atcggttttgttccaacatatgaagacttgaattgggaaggtactgagttcactaaagaa
caatttgacctcatcacaaatcaagatagagaccaatgggttactgaaattgaaagccac
actgagttattcaataaacttggcgaacgcttacctaaggcattaaaagaacgtcaagca
gctttacttgaagctgtaaaaactggcttctaa

DBGET integrated database retrieval system