KEGG   Acinetobacter baumannii AB0057: AB57_3307Help
Entry
AB57_3307         CDS       T00793                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00300  Lysine biosynthesis
abn01100  Metabolic pathways
abn01120  Microbial metabolism in diverse environments
abn01230  Biosynthesis of amino acids
Module
abn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AB57_3307
Enzymes [BR:abn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AB57_3307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer DUF3859 DUF3224
Motif
Other DBs
NCBI-ProteinID: ACJ41885
UniProt: B7I842
Position
3412932..3414065
Genome map
AA seq 377 aa AA seqDB search
MNHSDTLSLSLELLEQPSVTPIDHTCQTIMADRLAKVGFHIEPMRFGDVDNLWARRGTEG
PVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKH
PNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRR
GSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHA
GTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVG
ELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHD
LDPLTDIYEQILENLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagacactctctcgcttagcttagaacttttagaacagccttctgttacc
cctattgatcatacttgccaaactattatggctgaccgcttagctaaagttggcttccat
attgaacctatgcgctttggagatgtcgataatttatgggctcgacgtggaaccgaaggc
cctgtattttgttttgctggtcataccgacgtagtaccaacaggacgtttagacgcttgg
aattcagacccatttgcaccagaaattcgcgatggcaaattatatggtcgtggttcagca
gatatgaaaactgcattagctgcaatggtagttgcatctgaacgttttgtagcaaaacac
ccaaaccataaaggttcaattgcttttttaattacttcagatgaagaaggtcctgctgtt
aacggtaccgttaaagtcatcgaaacactggaaaagcgtaatgaaaaaattacttggtgt
ttggttggtgaaccatcaagtactcataaattaggtgatattgttaagaatggccgtcgt
ggttctcttaatgctgtattgaaggttcaaggcaaacaaggtcatgtagcttacccacac
ttggcacgtaatccaattcatgaagcatctccagcgttagctgagttgtgccaaacagtt
tgggacaatggcaatgagtatttccctgcaacttcattccagatttcaaatatccatgca
ggtactggcgcaaccaatgtaatccctggtgctttagaagttacttttaatttccgttat
tcaaccgaggttacagcagaacagcttaaacaacgtgttcatgaaattttagacaagcat
ggcttgcagtatgaaattgtctggaatttgtctggcttaccattcttaactccagtaggt
gaattagttaacgcagctcaaactgctattttaaatgtgactggtactgagactgagctt
tcaacaagtggtggtacatctgatggacgcttcattgctccaacaggtgcacaagtttta
gaactcggtgttctaaacgctactatccatcaaattaatgaacatgttgatgtacatgat
cttgatccattaactgatatttatgagcaaattttagagaacctacttgcttaa

DBGET integrated database retrieval system