KEGG   Acinetobacter baumannii AB0057: AB57_3525Help
Entry
AB57_3525         CDS       T00793                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:abn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AB57_3525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:abn03011]
    AB57_3525
Ribosome [BR:abn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AB57_3525
  Bacteria
    AB57_3525
  Archaea
    AB57_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1442
Motif
Other DBs
NCBI-ProteinID: ACJ42892
Position
complement(3637011..3637340)
Genome map
AA seq 109 aa AA seqDB search
MEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKALESAIANAEH
NNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRTCHITVKVGV
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgctaaattacgcggtgccgctatctcggcacaaaaagcacgtttggtt
gcggacttaatccgtggcaagtctgttgcacatgctttaaacatcttgaacttcagcaac
aaaaaagctgcagttttagttaaaaaagcattggaatctgcaattgcaaacgctgaacac
aataacagtttagatgttgacgaccttaaagtttctacgatttacgttgacgaaggcatg
agccttaaacgtattatgccacgtgctaaaggccgtgcagatcgtattactaagcgtact
tgtcacatcaccgttaaggtaggggtttga

DBGET integrated database retrieval system